Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATG16L2 Antibody
NBP2-92198-0.1mL 0.1 mL

Rabbit Polyclonal ATG16L2 Antibody

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C1271.08c (SPBC1271.08c), partial
MBS7070771 Inquire

Recombinant Schizosaccharomyces pombe Uncharacterized protein C1271.08c (SPBC1271.08c), partial

Sign In for Pricing
View Details
EPSTI1 ORF Vector (Human) (pORF)
ORF003610 1.0 µg DNA

EPSTI1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal METTL14 Antibody [Alexa Fluor 405]
NBP3-18489AF405 0.1 mL

Rabbit Polyclonal METTL14 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Acr (NM_012490) Rat Tagged ORF Clone Lentiviral Particle
RR204406L3V 200 µL

Acr (NM_012490) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PCSK1 (Proprotein Convertase Subtilisin/Kexin Type 1, BMIQ12, NEC1, PC1, PC3, SPC3) (MaxLight 490)
249885-ML490 100 µL

PCSK1 (Proprotein Convertase Subtilisin/Kexin Type 1, BMIQ12, NEC1, PC1, PC3, SPC3) (MaxLight 490)

Sign In for Pricing
View Details