Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATE1 siRNA (h)
sc-93923 10 µM

MATE1 siRNA (h)

Sign In for Pricing
View Details
Ppp1r14b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3655802 1.0 µg DNA

Ppp1r14b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
TRNAA33 sgRNA CRISPR Lentivector set (Human)
K2475401 3x 1.0 µg

TRNAA33 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Anti-Human CD3
GWB-C743B0 100 Tests

Mouse Anti-Human CD3

Sign In for Pricing
View Details
Rabbit Polyclonal Glucose 6 phosphate isomerase Antibody
NBP2-58524-25ul 25 µL

Rabbit Polyclonal Glucose 6 phosphate isomerase Antibody

Sign In for Pricing
View Details
Mouse Monoclonal FGF-8 Antibody (2A12)
H00002253-M03 0.1 mg

Mouse Monoclonal FGF-8 Antibody (2A12)

Sign In for Pricing
View Details