Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRMS1L Human shRNA Plasmid Kit (Locus ID 84312)
TR306371 1 Kit

BRMS1L Human shRNA Plasmid Kit (Locus ID 84312)

Sign In for Pricing
View Details
JMJD2D Antibody Blocking Peptide - (Dry Ice)
NBP1-03357PEP 0.1 mg

JMJD2D Antibody Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
Klra3 Protein Vector (Mouse) (pPB-C-His)
PV194958 500 ng

Klra3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human TBP shRNA (UAS) - Lentiviral human TBP shRNA (UAS) (100)
GTR15337221 1 Vial

Lentiviral human TBP shRNA (UAS) - Lentiviral human TBP shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Tmem88 qPCR Primer Pair
QM33262S 200 Tests

Mouse Tmem88 qPCR Primer Pair

Sign In for Pricing
View Details
Box of 100 Mce Syringe Filter 0.45µm, 33 Mm
SF33ME45C Box of 100

Box of 100 Mce Syringe Filter 0.45µm, 33 Mm

Sign In for Pricing
View Details