Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory receptor 8S1 discontinued
392572 200 µL

Olfactory receptor 8S1 discontinued

Sign In for Pricing
View Details
DRG1 Antibody
A72540-100UG 100 µg

DRG1 Antibody

Sign In for Pricing
View Details
MRPL51 Protein Vector (Mouse) (pPB-N-His)
PV202131 500 ng

MRPL51 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ECM1 Protein Vector (Mouse) (pPB-N-His)
PV174367 500 ng

ECM1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Monoclonal MMR/CD206/Mannose Receptor Antibody (S06-5I1)
NBP3-14900-100ul 100 µL

Rabbit Monoclonal MMR/CD206/Mannose Receptor Antibody (S06-5I1)

Sign In for Pricing
View Details
SNORD116-26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2248308 1.0 µg DNA

SNORD116-26 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details