Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT2A1, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult2a1-protein-human-his.html

Purity

98.0

Smiles

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Molecular Formula

6822 (Gene_ID) Q06520 (S2-E285) (Accession)

Molecular Weight

34-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRY2 (NM_021117) Human Recombinant Protein
PH38535M5 20 µg

CRY2 (NM_021117) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Sars M Antibody (2H2C4)
NBP1-28852-0.025mL 0.025 mL

Mouse Monoclonal Sars M Antibody (2H2C4)

Sign In for Pricing
View Details
OS9 Protein Vector (Human) (pPB-N-His)
PV029626 500 ng

OS9 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
G3BP1 (Ras GTPase-Activating Protein-Binding Protein 1, GTPase Activating Protein (SH3 Domain) Binding Protein 1)
481462 100 µL

G3BP1 (Ras GTPase-Activating Protein-Binding Protein 1, GTPase Activating Protein (SH3 Domain) Binding Protein 1)

Sign In for Pricing
View Details
MXI1 CytoSection
TS402332P5 25 Slides

MXI1 CytoSection

Sign In for Pricing
View Details
CMKLR1 Antibody
AF5291-01 100 µL

CMKLR1 Antibody

Sign In for Pricing
View Details