Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Rat (HEK293, His)

GM-CSF Protein, a cytokine, promotes the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer, interacting with the GM-CSF receptor complex, forming a dodecamer structure with two alpha, two beta, and two ligand subunits in head-to-head hexamers (By similarity) . GM-CSF Protein, Rat (HEK293, His) is the recombinant rat-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GM-CSF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-rat-hek-293-his.html

Purity

98.0

Smiles

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Formula

116630 (Gene_ID) P48750 (A18-K144) (Accession)

Molecular Weight

17-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), CF568 conjugate, 0.1mg/mL
BNC681879-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL
BNC401920-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (CDH16/1071), CF640R conjugate, 0.1mg/mL
BNC401071-100 1x 100 µL

Ksp-Cadherin / CDH16 (CDH16/1071), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF568 conjugate, 0.1mg/mL
BNC680512-100 1x 100 µL

CD68 (KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF405S conjugate, 0.1mg/mL
BNC042809-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details