Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Rat (HEK293, His)

GM-CSF Protein, a cytokine, promotes the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer, interacting with the GM-CSF receptor complex, forming a dodecamer structure with two alpha, two beta, and two ligand subunits in head-to-head hexamers (By similarity) . GM-CSF Protein, Rat (HEK293, His) is the recombinant rat-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GM-CSF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-rat-hek-293-his.html

Purity

98.0

Smiles

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Formula

116630 (Gene_ID) P48750 (A18-K144) (Accession)

Molecular Weight

17-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18 Adenovirus (Human)
25945051 1.0 mL

KRT18 Adenovirus (Human)

Sign In for Pricing
View Details
RN5S19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
39751061 1.0 µg DNA

RN5S19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SHP2 (PTPN11) (NM_002834) Human Recombinant Protein
E45H32461E1 50 µg

SHP2 (PTPN11) (NM_002834) Human Recombinant Protein

Sign In for Pricing
View Details
SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody (Fluoro647)
orb3091642 100 µg

SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Cellular retinoic acid-binding protein 2
AP87317 1 mg

Cellular retinoic acid-binding protein 2

Sign In for Pricing
View Details
F/IMO137-SA-PHOLUMC-150x150/1-B Marine & IMO Signs & Labels (Adhesive)
195048 1 Pack (1 Panel (s) x 1 Pack)

F/IMO137-SA-PHOLUMC-150x150/1-B Marine & IMO Signs & Labels (Adhesive)

Sign In for Pricing
View Details