Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Rat (CHO)

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Rat (CHO) is produced in CHO cells, and consists of 62 amino acids (I46-I107) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-rat-cho.html

Purity

97.00

Smiles

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Molecular Formula

246358 (Gene_ID) Q99ME0 (I46-I107) (Accession)

Molecular Weight

Approximately 7-9.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castor CW, et al. Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor. Proc Natl Acad Sci U S A. 1983 Feb;80 (3) :765-9.|[2]Schenk BI, et al. Platelet-derived chemokines CXC chemokine ligand (CXCL) 7, connective tissue-activating peptide III, and CXCL4 differentially affect and cross-regulate neutrophil adhesion and transendothelial migration. J Immunol. 2002 Sep 1;169 (5) :2602-10.|[3]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[4]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Hemopexin (HPX) ELISA Kit
RDR-HPX-Hu-01 96 Tests

Human Hemopexin (HPX) ELISA Kit

Sign In for Pricing
View Details
Human Hemopexin (HPX) ELISA Kit
RDR-HPX-Hu-02 48 Tests

Human Hemopexin (HPX) ELISA Kit

Sign In for Pricing
View Details
Quail Progesterone (PROG) ELISA Kit
YLA0004QU-01 48 Tests

Quail Progesterone (PROG) ELISA Kit

Sign In for Pricing
View Details
Quail Progesterone (PROG) ELISA Kit
YLA0004QU-02 96 Tests

Quail Progesterone (PROG) ELISA Kit

Sign In for Pricing
View Details
Depatuxizumab Biosimilar - Research Grade
ICH5294-200mg 200 mg

Depatuxizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Recombinant Mouse CD47 protein (Met1-Lys140)
CD47-380M 50 µg

Recombinant Mouse CD47 protein (Met1-Lys140)

Sign In for Pricing
View Details