Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Rat (CHO)

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Rat (CHO) is produced in CHO cells, and consists of 62 amino acids (I46-I107) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-rat-cho.html

Purity

97.00

Smiles

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Molecular Formula

246358 (Gene_ID) Q99ME0 (I46-I107) (Accession)

Molecular Weight

Approximately 7-9.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castor CW, et al. Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor. Proc Natl Acad Sci U S A. 1983 Feb;80 (3) :765-9.|[2]Schenk BI, et al. Platelet-derived chemokines CXC chemokine ligand (CXCL) 7, connective tissue-activating peptide III, and CXCL4 differentially affect and cross-regulate neutrophil adhesion and transendothelial migration. J Immunol. 2002 Sep 1;169 (5) :2602-10.|[3]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[4]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIA2 Rabbit Polyclonal Antibody
E28PT5779 100 µL

MIA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Parp8 (BC021315) Mouse Tagged Lenti ORF Clone
MR208030L4 10 µg

Parp8 (BC021315) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CASP14 3'UTR GFP Stable Cell Line
TU053514 1.0 mL

CASP14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Horse Protein BANP (BANP) ELISA Kit
MBS9943450-01 48 Well

Horse Protein BANP (BANP) ELISA Kit

Sign In for Pricing
View Details
Horse Protein BANP (BANP) ELISA Kit
MBS9943450-02 96 Well

Horse Protein BANP (BANP) ELISA Kit

Sign In for Pricing
View Details
Horse Protein BANP (BANP) ELISA Kit
MBS9943450-03 5x 96 Well

Horse Protein BANP (BANP) ELISA Kit

Sign In for Pricing
View Details