Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Rat (CHO)

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Rat (CHO) is produced in CHO cells, and consists of 62 amino acids (I46-I107) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-rat-cho.html

Purity

97.00

Smiles

IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

Molecular Formula

246358 (Gene_ID) Q99ME0 (I46-I107) (Accession)

Molecular Weight

Approximately 7-9.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castor CW, et al. Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor. Proc Natl Acad Sci U S A. 1983 Feb;80 (3) :765-9.|[2]Schenk BI, et al. Platelet-derived chemokines CXC chemokine ligand (CXCL) 7, connective tissue-activating peptide III, and CXCL4 differentially affect and cross-regulate neutrophil adhesion and transendothelial migration. J Immunol. 2002 Sep 1;169 (5) :2602-10.|[3]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[4]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VN1R1 (NM_020633) Human Tagged ORF Clone Lentiviral Particle
RC218783L1V 200 µL

VN1R1 (NM_020633) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rad52 siRNA Oligos set (Rat)
38427176 3x 5 nmol

Rad52 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Cavy Transcription Factor E2F7 (E2F7) ELISA Kit
MBS9351531 Inquire

Cavy Transcription Factor E2F7 (E2F7) ELISA Kit

Sign In for Pricing
View Details
Slpil2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV646426 1.0 µg DNA

Slpil2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Chicken Transmembrane Protein 106B (TMEM106B) ELISA Kit
MBS9915588 Inquire

Chicken Transmembrane Protein 106B (TMEM106B) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal RBM19 Antibody
NBP1-84135 0.1 mL

Rabbit Polyclonal RBM19 Antibody

Sign In for Pricing
View Details