Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Myosin-1 (MYH1), partial

Product Specifications

Product Name Alternative

(Myosin heavy chain 1) (Myosin heavy chain 2x) (MyHC-2x) (Myosin heavy chain, skeletal muscle, adult 1)

Abbreviation

Recombinant Bovine MYH1 protein, partial

Gene Name

MYH1

UniProt

Q9BE40

Expression Region

585-794aa

Organism

Bos taurus (Bovine)

Target Sequence

YAGTVDYNITGWLDKNKDPLNETVVGLYQKSSVKTLALLFSGPASGEAEGGPKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDVDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQLITRTQAR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Muscle contraction.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.9 kDa

References & Citations

"Myosin heavy chain isoforms expressed in bovine skeletal muscles." Chikuni K., Muroya S., Nakajima I. Meat Sci. 67:87-94 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF640R conjugate, 0.1mg/mL
BNC402395-500 1x 500 µL

CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC942562-100 1x 100 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF647 conjugate, 0.1mg/mL
BNC472026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF740 conjugate, 0.1mg/mL
BNC741815-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details