Beta-NGF, Mouse (110a.a, His)
Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes.The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth.Beta-NGF Protein, Mouse (110a.a, His) is the recombinant mouse-derived Beta-NGF protein, expressed by E.coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Beta-NGF Protein, Mouse (110a.a, His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/beta-ngf-protein-mouse-110a-a-his.html
Purity
95.00
Smiles
MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR
Molecular Formula
18049 (Gene_ID) P01139 (M130-R239) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Interferon alpha (IFN-alpha, IFNa, Interferon Type A1/A2, IFNA1, IFNA2, IFNA6)
UNC5CL (UNC5C-like Protein, Protein Unc-5 Homolog C-like, ZU5 and Death Domain-containing Protein, ZUD, MUXA) (PE)
