Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Mouse (110a.a, His)

Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes.The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth.Beta-NGF Protein, Mouse (110a.a, His) is the recombinant mouse-derived Beta-NGF protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Mouse (110a.a, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-mouse-110a-a-his.html

Purity

95.00

Smiles

MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

Molecular Formula

18049 (Gene_ID) P01139 (M130-R239) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Upb1 shRNA (UAS) - Lentiviral mouse Upb1 shRNA (UAS, GFP) (100)
GTR15217797 1 Vial

Lentiviral mouse Upb1 shRNA (UAS) - Lentiviral mouse Upb1 shRNA (UAS, GFP) (100)

Ask
View Details
Goat X-Box Binding Protein 1 ELISA Kit
MBS747666-01 48 Well

Goat X-Box Binding Protein 1 ELISA Kit

Ask
View Details
Goat X-Box Binding Protein 1 ELISA Kit
MBS747666-02 96 Well

Goat X-Box Binding Protein 1 ELISA Kit

Ask
View Details
Goat X-Box Binding Protein 1 ELISA Kit
MBS747666-03 5x 96 Well

Goat X-Box Binding Protein 1 ELISA Kit

Ask
View Details
Goat X-Box Binding Protein 1 ELISA Kit
MBS747666-04 10x 96 Well

Goat X-Box Binding Protein 1 ELISA Kit

Ask
View Details
MORN4 (NM_178832) Human Recombinant Protein
PH37203M5 20 µg

MORN4 (NM_178832) Human Recombinant Protein

Ask
View Details