Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Mouse (110a.a, His)

Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes.The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth.Beta-NGF Protein, Mouse (110a.a, His) is the recombinant mouse-derived Beta-NGF protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Mouse (110a.a, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-mouse-110a-a-his.html

Purity

95.00

Smiles

MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

Molecular Formula

18049 (Gene_ID) P01139 (M130-R239) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Glb1l3 (NM_001024358) Rat Tagged ORF Clone Lentiviral Particle
RR202581L4V 200 µL

Glb1l3 (NM_001024358) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Sheep C Reactive Protein ELISA Kit
MBS738645-01 48 Well

Sheep C Reactive Protein ELISA Kit

Ask
View Details
Sheep C Reactive Protein ELISA Kit
MBS738645-02 96 Well

Sheep C Reactive Protein ELISA Kit

Ask
View Details
Sheep C Reactive Protein ELISA Kit
MBS738645-03 5x 96 Well

Sheep C Reactive Protein ELISA Kit

Ask
View Details
Sheep C Reactive Protein ELISA Kit
MBS738645-04 10x 96 Well

Sheep C Reactive Protein ELISA Kit

Ask
View Details
RICH2, CT (ARHGAP44, KIAA0672, RICH2, Rho GTPase-activating protein 44, NPC-A-10, Rho-type GTPase-activating protein RICH2, RhoGAP interacting with CIP4 homologs protein 2) (Azide free) (HRP)
MBS6342108-01 0.2 mL

RICH2, CT (ARHGAP44, KIAA0672, RICH2, Rho GTPase-activating protein 44, NPC-A-10, Rho-type GTPase-activating protein RICH2, RhoGAP interacting with CIP4 homologs protein 2) (Azide free) (HRP)

Ask
View Details