Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-16, Human (His)

Galectin-16 is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 alters expression associated with cancer, diabetes, and brain disease. Animal-Free Galectin-16 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-16 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-16-protein-human-his.html

Purity

97

Smiles

SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR

Molecular Formula

148003 (Gene_ID) A8MUM7 (S2-R142) (Accession)

Molecular Weight

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-500 1x 500 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details