Animal-Free Galectin-16, Human (His)
Galectin-16 is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 alters expression associated with cancer, diabetes, and brain disease. Animal-Free Galectin-16 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-16 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free Galectin-16 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-galectin-16-protein-human-his.html
Purity
97
Smiles
SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR
Molecular Formula
148003 (Gene_ID) A8MUM7 (S2-R142) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
pCDH-CMV-MCS-EF1-Puro cDNA Cloning and Expression Vector
Human Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) ELISA Kit
Human Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4) ELISA Kit
Human Cysteine-Rich Secretory Protein LCCL Domain-Containing 2 (CRISPLD2) ELISA Kit