Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pleiotrophin, Mouse (HEK293, His)

Pleiotrophin (PTN) is a secreted growth factor that transduces signals through cell surface proteoglycan and non-proteoglycan receptors.PTN binds to chondroitin sulfate (CS) groups and regulates cell proliferation, survival, and differentiation, particularly inhibiting long-term synaptic potentiation of neurons.Pleiotrophin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Pleiotrophin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Pleiotrophin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pleiotrophin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Molecular Formula

19242 (Gene_ID) P63089 (G33-D168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRP7 Antibody (S64A-36) [Janelia Fluor 549]
NBP1-48318JF549 0.1 mL

Mouse Monoclonal TRP7 Antibody (S64A-36) [Janelia Fluor 549]

Sign In for Pricing
View Details
MOXD1 ORF Vector (Human) (pORF)
30342011 1.0 µg DNA

MOXD1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-BMP2 Antibody
MBS822189-01 0.03 mL

Anti-BMP2 Antibody

Sign In for Pricing
View Details
Anti-BMP2 Antibody
MBS822189-02 0.05 mL

Anti-BMP2 Antibody

Sign In for Pricing
View Details
Anti-BMP2 Antibody
MBS822189-03 0.1 mL

Anti-BMP2 Antibody

Sign In for Pricing
View Details
Anti-BMP2 Antibody
MBS822189-04 0.2 mL

Anti-BMP2 Antibody

Sign In for Pricing
View Details