Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrobacter hamburgensis Maf-like protein Nham_0113 (Nham_0113)

Product Specifications

CAS Number

9000-83-3

Gene Name

[Nham_0113]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[Nham_0113]

Short Name

[Maf-like protein Nham_0113 (Nham_0113)]

Other Product Names

[maf-like protein; Maf-like protein Nham_0113]

NCBI GI Number

499827987

NCBI Accession Number

WP_011508721.1

NCBI GB Accession Number

WP_011508721.1

Uniprot Accession Number

Q1QRY3

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FT113 2mg
A19402-2 2 mg

FT113 2mg

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein D (HSV I) (MaxLight 650) discontinued
H2033-19D-ML650 100 µL

Herpes Simplex Virus I, Glycoprotein D (HSV I) (MaxLight 650) discontinued

Sign In for Pricing
View Details
MRPL2 Antibody
MBS8500350-01 0.1 mg

MRPL2 Antibody

Sign In for Pricing
View Details
MRPL2 Antibody
MBS8500350-02 0.1 mL (AF405L)

MRPL2 Antibody

Sign In for Pricing
View Details