Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corylus avellana Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16

Product Specifications

Product Name Alternative

Allergen Cor a I; Cor a 1

Abbreviation

Recombinant Corylus avellana Allergen Cor a I protein

UniProt

Q08407

Expression Region

2-160aa

Organism

Corylus avellana (European hazel) (Corylus maxima)

Target Sequence

GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Allergen

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nap1l3 3'UTR GFP Stable Cell Line
TU263737 1.0 mL

Nap1l3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-RPH3AL antibody
STJ26615 100 µl

Anti-RPH3AL antibody

Sign In for Pricing
View Details
GCNT1, ID (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase, Core 2 Branching Enzyme, Core2-GlcNAc-transferase, C2GNT, Core 2 GNT, NACGT2) (FITC) discontinued
G3020-03-FITC 200 µL

GCNT1, ID (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase, Core 2 Branching Enzyme, Core2-GlcNAc-transferase, C2GNT, Core 2 GNT, NACGT2) (FITC) discontinued

Sign In for Pricing
View Details
CD20 (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1) (MaxLight 550) discontinued
C2270-06B-ML550 100 µL

CD20 (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
RT1-A1 Adenovirus (Rat)
42808056 1.0 mL

RT1-A1 Adenovirus (Rat)

Sign In for Pricing
View Details
Caspase 12 (CASP12) Antibody
abx318255-01 20 µg

Caspase 12 (CASP12) Antibody

Sign In for Pricing
View Details