EDNRB/Endothelin R Type B, Human (HEK293, His)
EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin R Type B Protein, Human (HEK293, His) is the recombinant human-derived EDNRB/Endothelin R Type B protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
EDNRB/Endothelin R Type B Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ednrb-endothelin-r-type-b-protein-human-hek293-his.html
Purity
92.00
Smiles
EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK
Molecular Formula
1910 (Gene_ID) P24530/NP_000106.1 (E27-K101) (Accession)
Molecular Weight
Approximately 16-33 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
