Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Goat anti-GAPDH Polyclonal antibody

Goat polyclonal to GAPDH (glyceraldehyde 3-phosphate dehydrogenase). GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.

Product Specifications

Specifications

Detects a band of 37 kDa by Western blot in the following human (293A, HMEC-1, U-118, HaCat), rat (TR-iBRB), mouse (AtT-20, Hepa), canine (D17) and monkey (COS-7) whole cell lysates.

Product Name Alternative

glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, G3PD, GAPD, HGNC:4141, GAPDH antibody.

UNSPSC Description

Glyceraldehyde-3-phosphate dehydrogenase

Volume

500 µL

Gene ID

ENSG00000111640

Accession Number

ENSG00000111640

Host

Goat

Antigen Species

Human

Reactivity

Human, mouse, rat, fish, bovine, canine, chicken/avian, donkey, feline, goat, guinea pig, hamster, horse, porcine, rabbit, sheep, simian, other

Immunogen

Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

Target Antigen

Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

Immunogen Type

Recombinant protein

Target

Anti-GAPDH

Clonality

Polyclonal

Isotype

IgG

Conjugation

Unconjugated

Type

Primary

Sequence

SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Applications

WB, IF, IHC-P, IHC-F

Purification

Epitope affinity purified

Concentration

2 mg/mL

Dilution

WB:1:500-1:5,000, IF:1:50-1:250, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000

Form

Polyclonal antibody supplied as a 200 or 500 µl (2 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Buffer

PBS, 20% glycerol and 0.05% sodium azide

References & Citations

1. Ferreira JV, Soares AR, Ramalho J, et al. Sci Adv 2022 Mar. PMID: 35333565 2. Martins-Marques T, Costa MC, Catarino S, et al. EMBO Rep 2022 May. PMID: 35593040 3. Wu Q, Sacomboio E, Souza LV, et al. bioRxiv 2022 4. Levin JB, Borodinsky LN. Cell Calcium 2022 Mar. PMID: 35074688 5. Monteiro-Alfredo T, Oliveira S, Amaro A, et al. Nutrients 2021 Aug. PMID: 34445015 6. Martins-Marques T, Ribeiro-Rodrigues T, de Jager SC, et al. Life Sci Alliance 2020 Oct. PMID: 33097557 7. Lee ACK, PhD Thesis, California University, Davis, United States 2020 8. Martins SGR, MSc Thesis, NOVA University of Lisbon, Portugal 2019 9. Ferreira JV, Rosa Soares A, Ramalho JS, et al. PLoS One 2019 Oct. PMID:31613922 10. Alenquer M, Vale-Costa S, Etibor TA, et al. Nat Commun 2019 Apr. PMID:30967547 11. Sanzà P, Evans RD, Briggs DA, et al. J Cell Sci 2019 Apr. PMID:30898842 12. Aires ID, Boia R, Rodrigues-Neves AC, et al. Glia 2019 Jan. PMID:30667095 13. Barbeitos JP, MSc Thesis, University of Coimbra, Portugal 2018 14. Alenquer M, Vale-Costa S, Sousa AL, et al. bioRxiv 410373; Sept 2018 15. Alzahofi N, Robinson CL, Welz T, et al. bioRxiv 314153; May 2018 16. Ribeiro ST, Tesio M, Ribot JC, et al. Leukemia 2017 Jul. PMID:27899804 17. Santarino IB, Viegas MS, Domingues NS, et al. Sci Rep 2017 Jul. PMID:28724916 18. Ribeiro STF, PhD Thesis, University of Lisbon, Portugal 2017 19. Robinson CL, Evans RD, Briggs DA, et al. J Cell Sci 2017 May. PMID:28490438 20. Ramalho AR, Toscano A, Pereira P, et al. Rev Port Cardiol 2017 May. PMID:28479269 21. Vale-Costa S, Alenquer M, Sousa AL, et al. J Cell Sci 2016 Mar. PMID:26940915 22. Encarnação M, Espada L, Escrevente C, et al. J Cell Biol 2016 Jun 20. PMID: 27325790 23. Ferreira JV, Soares AR, Ramalho JS, et al. Scientific Reports 2015 May. PMID:25958982 24. Ferreira RRS, MSc Thesis, University of Coimbra, Portugal 2015 25. Paiva RA, MSc Thesis, University of Coimbra, Portugal 2015 26. Casalou C, Seixas C, Portelinha A, et al. J Cell Sci 2014 Jun. PMID:24777479 27. Ribeiro-Rodrigues TM, Catarino S, Marques C, et al. FASEB J 2014 Nov. PMID:25070368 28. Moreiras HAF, MSc Thesis, University of Lisbon, Portugal 2014

Storage Conditions

For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.

CAS Number

9007-83-4

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

YY1 (H-10):m-IgG1 BP-HRP Bundle
sc-542802 1 Kit

YY1 (H-10):m-IgG1 BP-HRP Bundle

Ask
View Details
Human COQ4 Protein Lysate
MBS139786-01 0.02 mg

Human COQ4 Protein Lysate

Ask
View Details
Human COQ4 Protein Lysate
MBS139786-02 5x 0.02 mg

Human COQ4 Protein Lysate

Ask
View Details
Human pre-microRNA Expression Construct Lenti-miR-1288
PMIRH1288PA-1 Bacterial Streak

Human pre-microRNA Expression Construct Lenti-miR-1288

Ask
View Details
SLC2A1 Human Pre-designed siRNA Set A
HY-RS13157 1 Set

SLC2A1 Human Pre-designed siRNA Set A

Ask
View Details
Calbindin D28k Recombinant Guinea pig
214 318 50 µg

Calbindin D28k Recombinant Guinea pig

Ask
View Details