Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Goat anti-GFP Polyclonal antibody

Goat polyclonal antibody to GFP (green fluorescent protein). GFP is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to blue light. In cell and molecular biology, the GFP protein is frequently used as a reporter of expression.

Product Specifications

CAS Number

9007-83-4

Specifications

In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does not recognize mCherry fluorescent protein.

Product Name Alternative

Green fluorescent protein antibody.

UNSPSC Description

Green Fluorescent Protein

Volume

200 µL

Host

Goat

Reactivity

GFP

Immunogen

Purified recombinant peptide produced in E. coli.

Target Antigen

Purified recombinant peptide produced in E. coli.

Immunogen Type

Recombinant protein

Target

anti-GFP

Clonality

Polyclonal

Isotype

IgG

Conjugation

Unconjugated

Type

Primary

Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Applications

WB, IF, IHC-P, IHC-F

Purification

Epitope affinity purified

Concentration

3 mg/mL

Dilution

WB:1:500-1:5,000, IF:1:50-1:1,000, IHC-P:1:50-1:1,000, IHC-F:1:50-1:1,000, IEM:1:50-1:1,000

Form

Polyclonal antibody supplied as a 200 or 500 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Buffer

PBS, 20% glycerol and 0.05% sodium azide

References & Citations

1. Serifi I, Besta S, Karetsou Z, et al. Sci Rep 2021 Jul. PMID: 34230583 2. Castellanos-Jankiewicz A, Guzmán-Quevedo O, Fénelon VS, et al. Cell Metab 2021 Apr. PMID: 33887197 3. Fan L, Froehlich K, Melzer E, et al. bioRxiv, 2021 4. Yu Z, McIntosh JM, Sadeghi SG, et al. J Neurophysiol 2020 Aug. PMID: 32609559 5. Al-Saad RZ, Kerr I, Hume AN. ASSAY and Drug Development Technologies 2020 May. PMID: 32384245 6. Schlöffel MA, Salzer A, Wan WL, et al. Plant Physiol 2020 May. PMID: 32152212 7. Schlöffel M, Salzer A, Wan W, et al. bioRxiv 2020 8. Fröhlich K. PhD Thesis, University of Tübingen, Germany, 2020 9. Schlöffel MA, PhD Thesis, University of Tübingen, Germany, 2019 10. Zhang Y, Tang N, Luo J, et al. J Virol 2019 Aug. PMID:31189706 11. Meyers A, Furtmann C, Gesing K, et al. Microb Biotechnol 2019 Jun.PMID:31237428 12. Anjo SI, Melo MN, Loureiro LR, et al. Redox Biol 2019 Apr. PMID:30737169 13. Vicente MM, Mendes A, Cruz M, et al. bioRxiv 2019 14. Gassama A, PhD Thesis, Zurich University, Swizterland, 2018 15. Cardoso MHS, PhD Thesis, NOVA University of Lisbon, Portugal 2018 16. Almeida F, Luís MP, Pereira IS, et al. Front Cell Infect Microbiol 2018 Jul. PMID:30094225 17. Radtke C and Tews BA. J Gen Virol 2017 Oct. PMID:28874234 18. Wei-Lin Wan, PhD Thesis, University of Tubingen, Germany, 2017 19. Tiede C, Bedford R, Heseltine SJ, et al. Elife 2017 Jun. PMID:28654419 20. Gabriel SS, Belge H, Gassama A, et al. Kidney Int 2017 Apr. PMID:28143656 21. Krishnamurthy VV, Khamo JS, Mei W, et al. Development 2016 Nov. PMID:27697903 22. Zhang-Hooks Y, Agarwal A, Mishina M, et al. Neuron 2016 Jan (Supplemental Information). PMID:26774161 23. Carneiro L, Geller S, Fioramonti X, et al. Am J Physiol Endocrinol Metab 2016 Jan. PMID:26530151 24. Roux I, Wu JS, McIntosh JM, et al. J Neurophysiol 2016 Apr. PMID: 27098031 25. Bugalhão JN, Mota LJ, Franco IS. Microbiologyopen 2015 Dec. PMID:26626407 26. Sargiannidou I, Kim GH, Kyriakoudi S, et al. Neurogenetics 2015 Mar. PMID: 25771809 27. Issa JB, Haeffele BD, Agarwal A, et al. Neuron 2014 Aug (Supplemental Information). PMID:25088366 28. Moreiras HAF, MSc Thesis, University of Lisbon, Portugal, 2014

Storage Conditions

For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD154 / CD40L / TNFSF5 Monoclonal Antibody
ANT-10794-100ug 100 µg

CD154 / CD40L / TNFSF5 Monoclonal Antibody

Ask
View Details
Sart3 Mouse siRNA Oligo Duplex (Locus ID 53890)
SR421456 1 Kit

Sart3 Mouse siRNA Oligo Duplex (Locus ID 53890)

Ask
View Details
CheKine™ Micro Soil Neutral Phosphatase (S-NP) Activity Assay Kit
KTB4043-01 48 Tests - 48 Samples

CheKine™ Micro Soil Neutral Phosphatase (S-NP) Activity Assay Kit

Ask
View Details
CheKine™ Micro Soil Neutral Phosphatase (S-NP) Activity Assay Kit
KTB4043-02 96 Tests - 96 Samples

CheKine™ Micro Soil Neutral Phosphatase (S-NP) Activity Assay Kit

Ask
View Details
Stem Cell Factor (Kitlg, Mgf, Sl, Slf, SCF) (MaxLight 750) discontinued
215142-ML750 100 µL

Stem Cell Factor (Kitlg, Mgf, Sl, Slf, SCF) (MaxLight 750) discontinued

Ask
View Details
GIT2 Antibody
MBS8582252-01 0.1 mL

GIT2 Antibody

Ask
View Details