Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Goat anti-mCherry Polyclonal antibody

Goat polyclonal antibody to mCherry (Cherry fluorescent protein).

Product Specifications

Specifications

In 293HEK cells transfected with cds plasmid detects a band of 29 kDa by Western blot. This antibody (AB0040) recognizes very well tdTomato and does not recognize GFP (green fluorescent protein).

Product Name Alternative

Cherry fluorescent protein; dsRed, red fluorescent protein, tdTomato antibody.

UNSPSC Description

Red Fluorescent Protein

Volume

200 µL

Host

Goat

Reactivity

mCherry, tdTomato, RFP

Immunogen

Purified recombinant peptide produced in E. coli.

Target Antigen

Purified recombinant peptide produced in E. coli.

Immunogen Type

Recombinant protein

Target

anti-mCherry

Clonality

Polyclonal

Isotype

IgG

Conjugation

Unconjugated

Type

Primary

Sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Applications

WB, IF, IHC-P, IHC-F, IEM

Purification

Epitope affinity purified

Concentration

3 mg/mL

Dilution

WB:1:500-1:5,000, IF:1:50-1:500, IHC-P:1:50-1:500, IHC-F:1:50-1:500, IEM:1:50-1:500

Form

Polyclonal antibody supplied as a 200 or 500 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Buffer

PBS, 20% glycerol and 0.05% sodium azide

References & Citations

1. Dutta SB, Linneweber GA, Andriatsilavo M, et al. Curr Bio 2023 Jan. PMID: 36640763 2. Balmer TS, Trussell LO. Bio Protoc 2022 May. PMID: 35813023 3. Takahashi TM, Hirano A, Kanda T, et al. Cell Rep Methods 2022 Nov. PMID: 36452866 4. Letchuman S, Tucker A, Miranda D, et al. eNeuro 2022 Oct. PMID: 36265906 5. Boudjadja MB, Culotta I, Paula GCD, et al. Curr Biol 2022 Sep. PMID: 36182699 6. Bassi JK, Connelly AA, Butler AG, et al. J Comp Neurol 2022 Aug. PMID: 35988033 7. Hermanns T, Graf-Boxhorn S, Poeck B et al. Curr Biol 2022 Jul. PMID: 35914533 8. Yoshinaga S, Honda T, Kubo KI, et al. Neurosci Res 2022 Mar. PMID: 35364133 9. Ferreira JV, Soares AR, Ramalho J, et al. Sci Adv 2022 Mar. PMID: 35333565 10. Call CL, Neely SA, Early JJ, et al. bioRxiv Feb 2022 11. Wiegmann RP. PhD Thesis, Universitätsklinikum Hamburg Eppendorf, Hamburg, Germany, 2021 12. Sun W, Choi I, Stoyanov S, et al. Nat Commun 2021 Oct. PMID: 34663792 13. Pusic KM, Kraig RP, Pusic AD, et al. PLoS One 2021 Aug. PMID: 34388189 14. Escrevente C, Bento-Lopes L, Ramalho JS, et al. J Cell Sci 2021 May. PMID: 34002205 15. Sanchez-Aguilera A, Wheeler DW, Jurado-Parras T, et al. PLoS Biol 2021 May. PMID: 33956790 16. Kaise T and Kageyama R. Gene Expression Patterns Mar 2021. PMID: 33675998 17. Call CL and Bergles DE. bioRxiv 2021 18. Towler B, Pashler A, Haime H, et al. bioRxiv 2021 19. Yu Q, Du, M Zhang W, et al. Cell Mol Gastroenterol Hepatol 2020 Dec. PMID: 33340715 20. Lewis EM, Stein-O'Brien GL, Patino AV, et al. Neuron 2020 Nov. PMID: 33113347 21. Niu X, Liu L, Wang T, et al. J Neurosci 2020 Jul. PMID: 32690615 22. Cheung P, Xiol J, Dill MT, et al. Cell Stem Cell 2020 Jul. PMID: 32730753 23. Takahashi TM, Sunagawa GA, Soya S, et al. Nature 2020 Jun. PMID: 32528181 24. MacDonald AJ, Holmes FE, Beall C, et al. Glia 2020 Jun. PMID: 31880353 25. Ceto S, Sekiguchi KJ, Takashima Y, et al. Cell Stem Cell 2020 Jul. PMID: 32758426 26. Mikedis MM, Fan Y, Nicholls PK, et al. Elife 2020 Jul 20. PMID: 32686646 27. Neubarth NL, Emanuel AJ, Liu Y, et al. Science 2020 Jun. PMID: 32554568 28. Sun W, PhD Thesis, Otto von Guericke University Magdeburg, Germany 2020 29. Hastings RL, Massopust RT, Haddix SG. Skelet Muscle 2020 May. PMID: 32381068 30. Liu CY, Tsai CJ, Yasugaki S, et al. Neurosci Res 2020 Apr. PMID: 32283105 31. Cherqui S - US Patent App. 16/820,368, 2020 32. Yoon S, Parnell E, Kasherman M, et al. Neuron 2020 Feb. PMID: 31813652 33. Nguyen R, Venkatesan S, Binko M, et al. J Neurosci 2020 Jan. PMID:32005764 34. Wu JS, Yi E, Manca M, et al. Elife 2020 Jan. PMID:31975688 35. Touahri Y, Dixit R, Kofoed RH, et al. Theranostics 2020. PMID: 32194850 36. Bai L, Mesgarzadeh S, Ramesh KS, et al. Cell 2019 Nov. PMID:31730854 37. Riera TI, PhD Thesis, University of Munich, Germany 2019 38. Paixao S, Loschek L, Gaitanos L, et al. Neuron 2019 Oct. PMID:31586516 39. Pedone E, Postiglione L, Aulicino F, et al. Nat Commun 2019 Oct. PMID:31578371 40. Ceto S, Sekiguchi KJ, Takashima, Y, et al. bioRxiv 2019 41. Adler AF, Cardoso T, Nolbrant S, et al. Cell Rep 2019 Sep. PMID:31553914 42. Zheng Y, Liu P, Bai L, et al. Neuron 2019 Aug. PMID:31248728 43. Hsu KS, Otsu W, Li Y, et al. Sci Rep 2019 Aug. PMID:31439888 44. Rusu P, Shao C, Neuerburg A, et al. Cell Stem Cell 2019 Jul. PMID:31303549 45. Binder S, Molle M, Lippert M. J Neurosci 2019 Jul. PMID:31285301 46. Pepe-Mooney BJ, Dill MT, Alemany A, et al. Cell Stem Cell 2019 May. PMID:31080134 47. Cherqui S - US Patent App. 16/082,487, 2019 48. Krause T, Spindler L, Poeck B, et al. Curr Biol 2019 May. PMID:31104933 49. Balmer TS, Trussell LO. Elife 2019 Apr. PMID:30994458 50. Zhou X, Oishi Y, Cherasse Y, et al. Neurochem Int 2019 Mar. PMID:30690114 51. Otsu W, Hsu YC, Chuang JZ, et al. J Neurosci 2019 Feb. PMID:30819798 52. Kumamaru H, Lu P, Rosenzweig ES, et al. Cell Rep 2019 Feb. PMID:30811984 53. MacDonald AJ, Holmes FE, Beall C, et al. bioRxiv 2019 54. Guerrero-Juarez CF, Dedhia PH, Jin S, et al. Nat Commun 2019 Feb. PMID:30737373 55. Whissell PD, Bang JY, Khan I, et al. eNeuro 2019 Jan-Feb. PMID:30834305 56. Gao R, PhD Thesis, Northwestern University, USA 2018 57. Deshpande D, PhD Thesis, Ruperto-Carola University of Heidelberg, Germany 2018 58. Pedone E, Rocca DL, Postiglione L, et al. bioRxiv 404699; Sept 2018 59. D'Agostino G, Lyons D, Cristiano C, et al. Cell Metab 2018 Aug. PMID:30146485 60. Al-Osta I, Mucha M, Pereda D, et al. Front Cell Neurosci 2018 Jul. PMID:30072872 61. Movahedi K, Wiegmann R, De Vlaminck K, et al. Biotechnol Bioeng 2018 Jul. PMID:29573361 62. Cardoso T, Adler A, Mattsson B, et al. J Comp Neurol 2018 Jul. PMID:30007046 63. Miesfeld JB, Moon MS, Riesenberg AN, et al. Sci Rep 2018 Jul. PMID:29977079 64. Liu XS, Wu H, Krzisch M, et al. Cell 2018 Feb. PMID:29456084 65. Miesfeld JB, Glaser T, Brown NL. Gene Expr Patterns 2017 Dec. PMID:29225067 66. Oliveira CR, Lemaitre R, Tazaki A, et al. Dev Biol 2017 Oct. PMID:29198566 67. Lin B, Coleman JH, Peterson JN, et al. Cell Stem Cell 2017 Nov. PMID:29174332 68. Rocca CJ, Goodman SM, Dulin JN, et al. Sci Transl Med 2017 Oct. PMID:29070698 69. Kodani S, Soya S, Sakurai T. J Neurosc 2017 Jun. PMID:28642284 70. Saito M, Otsu W, Hsu KS, et al. EMBO Rep 2017 Jun. PMID:28607034 71. Castellano JM, Mosher KI, Abbey RJ, et al. Nature 2017 Apr. PMID:28424512 72. Shevelkin AV, Terrillion CE, Abazyan BN, et al. Neurobiol Dis 2017 Apr. PMID:28392471 73. Agarwal A, Wu PH, Hughes EG, et al. Neuron 2017. PMID:28132831 74. Abraira VE, Kuehn ED, Chirila AM, et al. Cell 2017 Jan. PMID:28041852 75. Krishnamurthy VV, Khamo JS, Mei W, et al. Development 2016 Nov. PMID:27697903 76. Espinosa-Medina I, Saha O, Boismoreau F, et al. Science 2016 Nov. Supplemental Information, PMID:27856909 77. Falkner S, Grade S, Dimou L, et al. Nature 2016 Oct. PMID:27783592 78. Vyas P, Wu JS, Zimmerman A, et al. J. Assoc. Res. Otolaryngol 2016 Sep. PMID:27696081 79. Sargiannidou I, Kim GH, Kyriakoudi S, et al. Neurogenetics 2015 Jul. PMID:25771809 80. Merienne N, Delzor A, Viret A, et al. Gene Thep 2015 Oct. PMID:26109254 81. Viheriala T, MSc Thesis, University of Tampere, Finland, 2014

Storage Conditions

For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.

CAS Number

9007-83-4

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FT Antibody
A78739-50UL 50 µL

FT Antibody

Ask
View Details
Human FOXD4L6 shRNA Plasmid
abx968572-01 150 µg

Human FOXD4L6 shRNA Plasmid

Ask
View Details
Human FOXD4L6 shRNA Plasmid
abx968572-02 300 µg

Human FOXD4L6 shRNA Plasmid

Ask
View Details
Anti-CD63 Antibody
MBS8292185-01 0.03 mL

Anti-CD63 Antibody

Ask
View Details
Anti-CD63 Antibody
MBS8292185-02 0.05 mL

Anti-CD63 Antibody

Ask
View Details
Anti-CD63 Antibody
MBS8292185-03 0.1 mL

Anti-CD63 Antibody

Ask
View Details