Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF5, Human (His)

ARF5 Protein, Human (His) is the recombinant human-derived ARF5 protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

ARF5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arf5-protein-human-his.html

Purity

98.0

Smiles

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Molecular Formula

/ (Gene_ID) AAP36805 (M1-R180) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5.5 Anti-Human CD49d Antibody[9F10]
E-AB-F1144I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD49d Antibody[9F10]
E-AB-F1144I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD49d Antibody[9F10]
E-AB-F1144I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
Human RSRC2 activation kit by CRISPRa
GA112240 1 Kit

Human RSRC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703735 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CF®640R Monoclonal Mouse Anti-Fluorescein (FITC) IgG, 2 mg/mL
#20213-1 1x 50 µL

CF®640R Monoclonal Mouse Anti-Fluorescein (FITC) IgG, 2 mg/mL

Sign In for Pricing
View Details