Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF5, Human (His)

ARF5 Protein, Human (His) is the recombinant human-derived ARF5 protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

ARF5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arf5-protein-human-his.html

Purity

98.0

Smiles

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Molecular Formula

/ (Gene_ID) AAP36805 (M1-R180) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf2 (URI1) Rabbit Polyclonal Antibody
TA363783 100 µL

C19orf2 (URI1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), CF405S conjugate, 0.1mg/mL
BNC040687-100 1x 100 µL

Cytokeratin 8 (H1 + TS1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-2-[2-(4-hexylphenyl)ethyl]-1,3-propanediol
TRC-A611073-50MG 50 mg

2-Amino-2-[2-(4-hexylphenyl)ethyl]-1,3-propanediol

Sign In for Pricing
View Details
VILL (NM_015873) Human Recombinant Protein
TP315217M 100 µg

VILL (NM_015873) Human Recombinant Protein

Sign In for Pricing
View Details
ORC2 Rabbit Polyclonal Antibody
TA379494 100 µL

ORC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRPV6 (NM_018646) Human Over-expression Lysate
LC402703 20 µg

TRPV6 (NM_018646) Human Over-expression Lysate

Sign In for Pricing
View Details