Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF5, Human (His)

ARF5 Protein, Human (His) is the recombinant human-derived ARF5 protein, expressed by E. coli, with N-His labeled tag.

Product Specifications

Product Name Alternative

ARF5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arf5-protein-human-his.html

Purity

98.0

Smiles

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Molecular Formula

/ (Gene_ID) AAP36805 (M1-R180) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM38 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI113D3]
TA505981AM 100 µL

TRIM38 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI113D3]

Sign In for Pricing
View Details
Thymine DNA glycosylase (TDG) (NM_003211) Human Over-expression Lysate
LY401109 100 µg

Thymine DNA glycosylase (TDG) (NM_003211) Human Over-expression Lysate

Sign In for Pricing
View Details
HIV-1 Nef / HXB2 (35-50) Mouse Monoclonal Antibody [Clone ID: 3D12 (01-002)]
AM26075PU-N 100 µg

HIV-1 Nef / HXB2 (35-50) Mouse Monoclonal Antibody [Clone ID: 3D12 (01-002)]

Sign In for Pricing
View Details
RNPEP Human Gene Knockout Kit (CRISPR)
KN400756 1 Kit

RNPEP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505315 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Cropropamide
TRC-C815020-50MG 50 mg

Cropropamide

Sign In for Pricing
View Details