Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MCP-1/CCL2, Pig (His)

MCP-1/CCL2 protein acts as a ligand for CCR2, inducing chemotactic responses and calcium mobilization. It attracts monocytes and basophils but not neutrophils or eosinophils. Animal-Free MCP-1/CCL2 Protein, Pig (His) is the recombinant pig-derived animal-Free MCP-1/CCL2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MCP-1/CCL2 Protein, Pig (His), Pig, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ccl2-protein-pig-his.html

Purity

98.0

Smiles

QPDAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKQKWVQDSISHLDKKNQTPKP

Molecular Formula

397422 (Gene_ID) P42831 (Q24-P99) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CECR2 Rabbit Polyclonal Antibody
TA360982 100 µL

CECR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SHCBP1L Antibody
KC-42161-01 50 μL

SHCBP1L Antibody

Sign In for Pricing
View Details
SHCBP1L Antibody
KC-42161-02 100 µL

SHCBP1L Antibody

Sign In for Pricing
View Details
SHCBP1L Antibody
KC-42161-03 1 mL

SHCBP1L Antibody

Sign In for Pricing
View Details
Sfn Mouse Gene Knockout Kit (CRISPR)
KN515651 1 Kit

Sfn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Transthyretin (Prealbumin) (CPTC-TTR-1), 0.2mg/mL
BNUB2249-500 1x 500 µL

Transthyretin (Prealbumin) (CPTC-TTR-1), 0.2mg/mL

Sign In for Pricing
View Details