Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDNF, Human (HEK293, His)

CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA) -induced degeneration of dopaminergic neurons. CDNF Protein, Human (HEK293, His) is the recombinant human-derived CDNF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CDNF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdnf-protein-human-hek-293-his.html

Purity

95.0

Smiles

QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

Molecular Formula

441549 (Gene_ID) Q49AH0-1 (Q25-L187) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit
MBS452283-01 48 Tests

Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit

Ask
View Details
Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit
MBS452283-02 96 Tests

Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit

Ask
View Details
Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit
MBS452283-03 5x 96 Tests

Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit

Ask
View Details
Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit
MBS452283-04 10x 96 Tests

Mouse Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) ELISA Kit

Ask
View Details
DCUN1D4 Peptide - middle region
MBS3247640-01 0.1 mg

DCUN1D4 Peptide - middle region

Ask
View Details
DCUN1D4 Peptide - middle region
MBS3247640-02 5x 0.1 mg

DCUN1D4 Peptide - middle region

Ask
View Details