Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDNF, Human (HEK293, His)

CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA) -induced degeneration of dopaminergic neurons. CDNF Protein, Human (HEK293, His) is the recombinant human-derived CDNF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CDNF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdnf-protein-human-hek-293-his.html

Purity

95.0

Smiles

QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

Molecular Formula

441549 (Gene_ID) Q49AH0-1 (Q25-L187) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF405S conjugate, 0.1mg/mL
BNC041829-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (1415-1), CF740 conjugate, 0.1mg/mL
BNC740580-100 1x 100 µL

Histone H1 (1415-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC275), CF740 conjugate, 0.1mg/mL
BNC740275-500 1x 500 µL

C-Myc (MYC275), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details