Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 17 protein (CCL17) (Active)

Product Specifications

Product Name Alternative

CC chemokine TARC, Thymus and activation-regulated chemokine

Abbreviation

Recombinant Human CCL17 protein (Active)

Gene Name

CCL17

UniProt

Q92583

Expression Region

24-94aa

Organism

Homo sapiens (Human)

Target Sequence

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4. {ECO:0000269|PubMed:10540332}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20mM PB, pH 7.4, 150mM NaCl

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.

Molecular Weight

8.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLVX-TetOne-IRES-Puro Plasmid
PVT49841 2 µg

PLVX-TetOne-IRES-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral human RFESD shRNA (UAS) - Lentiviral human RFESD shRNA (UAS) (100)
GTR15122430 1 Vial

Lentiviral human RFESD shRNA (UAS) - Lentiviral human RFESD shRNA (UAS) (100)

Sign In for Pricing
View Details
Guinea pig Glycerol-3-phosphate acyltransferase 3 (AGPAT9) ELISA Kit
EIA06983Gu 1 Kit

Guinea pig Glycerol-3-phosphate acyltransferase 3 (AGPAT9) ELISA Kit

Sign In for Pricing
View Details
CSRP3, ID (CSRP3, CLP, MLP, Cysteine and glycine-rich protein 3, Cardiac LIM protein, Cysteine-rich protein 3, LIM domain protein, cardiac, Muscle LIM protein) (FITC)
MBS6289476-01 0.2 mL

CSRP3, ID (CSRP3, CLP, MLP, Cysteine and glycine-rich protein 3, Cardiac LIM protein, Cysteine-rich protein 3, LIM domain protein, cardiac, Muscle LIM protein) (FITC)

Sign In for Pricing
View Details
CSRP3, ID (CSRP3, CLP, MLP, Cysteine and glycine-rich protein 3, Cardiac LIM protein, Cysteine-rich protein 3, LIM domain protein, cardiac, Muscle LIM protein) (FITC)
MBS6289476-02 5x 0.2 mL

CSRP3, ID (CSRP3, CLP, MLP, Cysteine and glycine-rich protein 3, Cardiac LIM protein, Cysteine-rich protein 3, LIM domain protein, cardiac, Muscle LIM protein) (FITC)

Sign In for Pricing
View Details
2,3,4,6-Tetra-O-benzyl-β-D-galactopyranosyl trichloroacetimidate
GC6047-500mg 500 mg

2,3,4,6-Tetra-O-benzyl-β-D-galactopyranosyl trichloroacetimidate

Sign In for Pricing
View Details