Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse ADAM DEC1 (Adamdec1)

Product Specifications

Product Name Alternative

A disintegrin and metalloproteinase domain-like protein decysin-1

Abbreviation

Recombinant Mouse Adamdec1 protein

Gene Name

Adamdec1

UniProt

Q9R0X2

Expression Region

209-467aa

Organism

Mus musculus (Mouse)

Target Sequence

NEDLLQGQKYIGLFLVLDNAYYKLYNGNVTQMRTFLFKVLNLLNMIYKTINIQVSLVGMEIWSDQDKIKVEPNLGATFTHFMRWHYSNLGKRIHNHAQLLSGASFRHGRVGMAAGNSFCTTSSVSVIEAKKKNNVALVALMSHELGHALGMKDVPYYTKCPSGSCVMNQYLSSKFPKDFSTVSRSHFQGFLSSRNARCLLLAPDPKNIIKPTCGNQVLDVGEECDCGSPEECTNLCCEPLTCRLKSQPDCSEASNHITE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Biochemicals

Relevance

May play an important role in the control of the immune response and during pregnancy.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYR1A Antibody
8C11002-AAT 50 µg

DYR1A Antibody

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Podoplanin/PDPN Protein (His Tag)
PKSM040776 100 µg

Recombinant Mouse Podoplanin/PDPN Protein (His Tag)

Sign In for Pricing
View Details
Mitochondrial Complex II Activity Assay Kit
E-BC-K150-M-01 48 T (46 samples)

Mitochondrial Complex II Activity Assay Kit

Sign In for Pricing
View Details
Mitochondrial Complex II Activity Assay Kit
E-BC-K150-M-02 96 T (94 samples)

Mitochondrial Complex II Activity Assay Kit

Sign In for Pricing
View Details
Il2ra Rat Monoclonal Antibody [Clone ID: PC61.5.3]
AM26037LE-M 500 µg

Il2ra Rat Monoclonal Antibody [Clone ID: PC61.5.3]

Sign In for Pricing
View Details