Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma hyopneumoniae Elongation factor P (efp)

Product Specifications

CAS Number

9000-83-3

Gene Name

[efp]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[efp; EF-P]

Short Name

[Elongation factor P (efp)]

Other Product Names

[elongation factor P; Elongation factor P]

NCBI GI Number

499609511

NCBI Accession Number

WP_011290245.1

NCBI GB Accession Number

WP_011290245.1

Uniprot Accession Number

Q4A7U4

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luria-Bertani (LB) Lennox Agar Plates w/ Carb-50
30629322-2 40 Plates

Luria-Bertani (LB) Lennox Agar Plates w/ Carb-50

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Recombinant Human IGF1 Isoform 2 Protein, Untagged, E.coli-5mg
QP10392-ec-5mg 5mg

Recombinant Human IGF1 Isoform 2 Protein, Untagged, E.coli-5mg

Sign In for Pricing
View Details
Rat 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1,PLCG1 ELISA KIT
JOT-EK1833Ra 96 wells

Rat 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1,PLCG1 ELISA KIT

Sign In for Pricing
View Details
Ambenoxan (hydrochloride)
HY-121670A 1 Each

Ambenoxan (hydrochloride)

Sign In for Pricing
View Details
GJA1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV762181 1.0 µg DNA

GJA1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details