VSTM1, Human (119a.a, HEK293, His)
VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (119a.a, HEK293, His) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
VSTM1 Protein, Human (119a.a, HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vstm1-protein-human-hek-293-his.html
Smiles
YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRT
Molecular Formula
284415 (Gene_ID) Q6UX27 (Y17-T135) (Accession)
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog