Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXO4-DRI (acetate)

FOXO4-DRI acetate is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI acetate is a senolytic peptide that induces apoptosis of senescent cells[1].

Product Specifications

UNSPSC

12352209

Target

Apoptosis; MDM-2/p53

Type

Peptides

Related Pathways

Apoptosis

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/foxo4-dri-acetate.html

Solubility

H2O

Smiles

[D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)(acetatesalt)]

Molecular Formula

C228H388N86O64.0.145C2H4O2

Molecular Weight

5366.77

References & Citations

[1]Zhang C, et al. FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. Aging (Albany NY) . 2020 Jan 20;12 (2) :1272-1284.|[2]Huang Y, et al. Senolytic Peptide FOXO4-DRI Selectively Removes Senescent Cells From in vitro Expanded Human Chondrocytes. Front Bioeng Biotechnol. 2021 Apr 29;9:677576.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysophospholipid acyltransferase LPCAT4 (LPCAT4) Mouse ELISA Kit
E7868 96 Tests

Lysophospholipid acyltransferase LPCAT4 (LPCAT4) Mouse ELISA Kit

Sign In for Pricing
View Details
OAOA22314-50UG - KRT19 Detection Antibody
OAOA22314-50UG 50 µg

OAOA22314-50UG - KRT19 Detection Antibody

Sign In for Pricing
View Details
NCR3 (Natural Cytotoxicity Triggering Receptor 3, 1C7, MALS, CD337, LY117, NKp30) (MaxLight 650)
MBS6447886-01 0.1 mL

NCR3 (Natural Cytotoxicity Triggering Receptor 3, 1C7, MALS, CD337, LY117, NKp30) (MaxLight 650)

Sign In for Pricing
View Details
NCR3 (Natural Cytotoxicity Triggering Receptor 3, 1C7, MALS, CD337, LY117, NKp30) (MaxLight 650)
MBS6447886-02 5x 0.1 mL

NCR3 (Natural Cytotoxicity Triggering Receptor 3, 1C7, MALS, CD337, LY117, NKp30) (MaxLight 650)

Sign In for Pricing
View Details
Xylene Mixture of Isomers For Molecular Biology
2848B 02500 2.5 L

Xylene Mixture of Isomers For Molecular Biology

Sign In for Pricing
View Details
At1g01350 Antibody
orb785264 2 mg

At1g01350 Antibody

Sign In for Pricing
View Details