Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Lysosome-associated membrane glycoprotein 5 (LAMP5), partial

Product Specifications

Product Name Alternative

Brain and dendritic cell-associated LAMP Brain-associated LAMP-like protein

Abbreviation

Recombinant Pongo abelii LAMP5 protein, partial

Gene Name

LAMP5

UniProt

Q5R5V2

Expression Region

30-234aa

Organism

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Target Sequence

EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25 kDa

References & Citations

"A 6x draft sequence assembly of the Pongo pygmaeus abelii genome." Wilson R.K., Mardis E. Submitted (FEB-2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (S100B/1012), CF740 conjugate, 0.1mg/mL
BNC741012-500 1x 500 µL

S100B (S100B/1012), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF488A conjugate, 0.1mg/mL
BNC880844-500 1x 500 µL

Cytokeratin 10 (KRT10/844), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL
BNC680919-500 1x 500 µL

CD68 (CD68/G2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details