Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR8, Human (P. pastoris, His, Myc)

CCR8 Protein-VLP, a receptor for CCL1/SCYA1/I-309, may regulate monocyte chemotaxis and thymic cell line apoptosis. It also acts as an alternative coreceptor with CD4 for HIV-1 infection, facilitating viral entry. The interaction with CCL1 highlights its role in mediating cellular responses to this chemokine, implying a regulatory function in immune and inflammatory processes. CCR8 Protein, Human (P. pastoris, His) is the recombinant human-derived CCR8 protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CCR8 Protein, Human (P. pastoris, His, Myc), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccr8-protein-human-p-pastoris-his.html

Smiles

MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK

Molecular Formula

1237 (Gene_ID) P51685 (M1-K35) (Accession)

Molecular Weight

7.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-100 1x 100 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details