CCR8, Human (P. pastoris, His, Myc)
CCR8 Protein-VLP, a receptor for CCL1/SCYA1/I-309, may regulate monocyte chemotaxis and thymic cell line apoptosis. It also acts as an alternative coreceptor with CD4 for HIV-1 infection, facilitating viral entry. The interaction with CCL1 highlights its role in mediating cellular responses to this chemokine, implying a regulatory function in immune and inflammatory processes. CCR8 Protein, Human (P. pastoris, His) is the recombinant human-derived CCR8 protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.
Product Specifications
Product Name Alternative
CCR8 Protein, Human (P. pastoris, His, Myc), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccr8-protein-human-p-pastoris-his.html
Smiles
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK
Molecular Formula
1237 (Gene_ID) P51685 (M1-K35) (Accession)
Molecular Weight
7.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog