Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Follistatin-related protein 1 (FSTL1), partial

Product Specifications

Product Name Alternative

(Follistatin-like protein 1)

Abbreviation

Recombinant Human FSTL1 protein, partial

Gene Name

FSTL1

UniProt

Q12841

Expression Region

176-285aa

Organism

Homo sapiens (Human)

Target Sequence

ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation. Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter. Promotes endothelial cell survival, migration and differentiation into network structures in an AKT-dependent manner. Also promotes survival of cardiac myocytes. Initiates various signaling cascades by activating different receptors on the cell surface such as DIP2A, TLR4 or BMP receptors.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.8 kDa

References & Citations

"Fstl1 Promotes Glioma Growth Through the BMP4/Smad1/5/8 Signaling Pathway." Jin X., Nie E., Zhou X., Zeng A., Yu T., Zhi T., Jiang K., Wang Y., Zhang J., You Y. Cell. Physiol. Biochem. 44:1616-1628 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC6 (NM_002806) Human Recombinant Protein
TP761520 50 µg

PSMC6 (NM_002806) Human Recombinant Protein

Sign In for Pricing
View Details
SLC25A6 (NM_001636) Human Tagged ORF Clone Lentiviral Particle
RC203878L1V 200 µL

SLC25A6 (NM_001636) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cnpy1 Mouse shRNA Plasmid (Locus ID 269637)
TR512355 1 Kit

Cnpy1 Mouse shRNA Plasmid (Locus ID 269637)

Sign In for Pricing
View Details
MAST1 Double Nickase Plasmid (h2)
sc-405384-NIC-2 20 µg

MAST1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Olfr115 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4247004 1.0 µg DNA

Olfr115 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Helicobacter Pylori prfA Protein (aa 1-352)
VAng-Lsx3522-50gEcoli 50 µg (E. coli)

Recombinant Helicobacter Pylori prfA Protein (aa 1-352)

Sign In for Pricing
View Details