Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCMA/TNFRSF17, Human (HEK293, His)

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

BCMA/TNFRSF17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcma-tnfrsf17-protein-human-hek293-his.html

Purity

98.0

Smiles

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Molecular Formula

608 (Gene_ID) Q02223 (M1-A54) (Accession)

Molecular Weight

16.9&12.4 kDa

References & Citations

[1]Nobari ST, et al. B-cell maturation antigen targeting strategies in multiple myeloma treatment, advantages and disadvantages. J Transl Med. 2022 Feb 10;20 (1) :82.|[2]Yu B, et al. BCMA-targeted immunotherapy for multiple myeloma. J Hematol Oncol. 2020 Sep 17;13 (1) :125.|[3]Perez-Amill L, et al. Preclinical development of a humanized chimeric antigen receptor against B cell maturation antigen for multiple myeloma. Haematologica. 2021 Jan 1;106 (1) :173-184.|[4]Sanchez E, et al. Soluble B-Cell Maturation Antigen Mediates Tumor-Induced Immune Deficiency in Multiple Myeloma. Clin Cancer Res. 2016 Jul 1;22 (13) :3383-97.|[5]O'Connor BP, et al. BCMA is essential for the survival of long-lived bone marrow plasma cells. J Exp Med. 2004 Jan 5;199 (1) :91-8.|[6]Tai YT, et al. APRIL and BCMA promote human multiple myeloma growth and immunosuppression in the bone marrow microenvironment. Blood. 2016 Jun 23;127 (25) :3225-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal p38 delta/SAPK4 Antibody (OTI12B2) [PerCP]
NBP2-73188PCP 0.1 mL

Mouse Monoclonal p38 delta/SAPK4 Antibody (OTI12B2) [PerCP]

Sign In for Pricing
View Details
Zgpat Rat siRNA Oligo Duplex (Locus ID 296478)
SR503245 1 Kit

Zgpat Rat siRNA Oligo Duplex (Locus ID 296478)

Sign In for Pricing
View Details
Dhx37 (NM_203319) Mouse Tagged ORF Clone Lentiviral Particle
MR211713L4V 200 µL

Dhx37 (NM_203319) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal MALT1 Antibody
NBP2-24732SS 0.025 mg

Rabbit Polyclonal MALT1 Antibody

Sign In for Pricing
View Details
Recombinant Human ISOC2 Protein, His, E.coli-2ug
QP12461-2ug 2ug

Recombinant Human ISOC2 Protein, His, E.coli-2ug

Sign In for Pricing
View Details
Recombinant Escherichia coli Probable malonic semialdehyde reductase RutE (rutE)
MBS1229873-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Probable malonic semialdehyde reductase RutE (rutE)

Sign In for Pricing
View Details