Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCMA/TNFRSF17, Human (HEK293, His)

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

BCMA/TNFRSF17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcma-tnfrsf17-protein-human-hek293-his.html

Purity

98.0

Smiles

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Molecular Formula

608 (Gene_ID) Q02223 (M1-A54) (Accession)

Molecular Weight

16.9&12.4 kDa

References & Citations

[1]Nobari ST, et al. B-cell maturation antigen targeting strategies in multiple myeloma treatment, advantages and disadvantages. J Transl Med. 2022 Feb 10;20 (1) :82.|[2]Yu B, et al. BCMA-targeted immunotherapy for multiple myeloma. J Hematol Oncol. 2020 Sep 17;13 (1) :125.|[3]Perez-Amill L, et al. Preclinical development of a humanized chimeric antigen receptor against B cell maturation antigen for multiple myeloma. Haematologica. 2021 Jan 1;106 (1) :173-184.|[4]Sanchez E, et al. Soluble B-Cell Maturation Antigen Mediates Tumor-Induced Immune Deficiency in Multiple Myeloma. Clin Cancer Res. 2016 Jul 1;22 (13) :3383-97.|[5]O'Connor BP, et al. BCMA is essential for the survival of long-lived bone marrow plasma cells. J Exp Med. 2004 Jan 5;199 (1) :91-8.|[6]Tai YT, et al. APRIL and BCMA promote human multiple myeloma growth and immunosuppression in the bone marrow microenvironment. Blood. 2016 Jun 23;127 (25) :3225-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bag Heat Seal 190 x 330 x 65mm
AUT1450 500 / PCK

Bag Heat Seal 190 x 330 x 65mm

Sign In for Pricing
View Details
RGH-5526 50mg
A12454-50 50 mg

RGH-5526 50mg

Sign In for Pricing
View Details
Mouse Monoclonal Lamin A + C R482W Antibody (5H8-B4)
NBP1-77402SS 0.025 mL

Mouse Monoclonal Lamin A + C R482W Antibody (5H8-B4)

Sign In for Pricing
View Details
LGR5, ID (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38)
037758 200 µL

LGR5, ID (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38)

Sign In for Pricing
View Details
Human ACSBG2 Protein Lysate
MBS136781-01 0.02 mg

Human ACSBG2 Protein Lysate

Sign In for Pricing
View Details
Human ACSBG2 Protein Lysate
MBS136781-02 5x 0.02 mg

Human ACSBG2 Protein Lysate

Sign In for Pricing
View Details