Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCMA/TNFRSF17, Human (HEK293, His)

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

BCMA/TNFRSF17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcma-tnfrsf17-protein-human-hek293-his.html

Purity

98.0

Smiles

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Molecular Formula

608 (Gene_ID) Q02223 (M1-A54) (Accession)

Molecular Weight

16.9&12.4 kDa

References & Citations

[1]Nobari ST, et al. B-cell maturation antigen targeting strategies in multiple myeloma treatment, advantages and disadvantages. J Transl Med. 2022 Feb 10;20 (1) :82.|[2]Yu B, et al. BCMA-targeted immunotherapy for multiple myeloma. J Hematol Oncol. 2020 Sep 17;13 (1) :125.|[3]Perez-Amill L, et al. Preclinical development of a humanized chimeric antigen receptor against B cell maturation antigen for multiple myeloma. Haematologica. 2021 Jan 1;106 (1) :173-184.|[4]Sanchez E, et al. Soluble B-Cell Maturation Antigen Mediates Tumor-Induced Immune Deficiency in Multiple Myeloma. Clin Cancer Res. 2016 Jul 1;22 (13) :3383-97.|[5]O'Connor BP, et al. BCMA is essential for the survival of long-lived bone marrow plasma cells. J Exp Med. 2004 Jan 5;199 (1) :91-8.|[6]Tai YT, et al. APRIL and BCMA promote human multiple myeloma growth and immunosuppression in the bone marrow microenvironment. Blood. 2016 Jun 23;127 (25) :3225-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab8a sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3728802 1.0 µg DNA

Rab8a sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CHST11, Human (sf9, His)
HY-P76257 1 Each

CHST11, Human (sf9, His)

Sign In for Pricing
View Details
Lentiviral human MIEN1 shRNA (UAS) - Lentiviral human MIEN1 shRNA (UAS) (100)
GTR15311853 1 Vial

Lentiviral human MIEN1 shRNA (UAS) - Lentiviral human MIEN1 shRNA (UAS) (100)

Sign In for Pricing
View Details
KLHDC7B Human shRNA Plasmid Kit (Locus ID 113730)
TR303662 1 Kit

KLHDC7B Human shRNA Plasmid Kit (Locus ID 113730)

Sign In for Pricing
View Details
Lentiviral mouse Ccar1 shRNA (UAS) - Lentiviral mouse Ccar1 shRNA (UAS, iRFP) (100)
GTR15229635 1 Vial

Lentiviral mouse Ccar1 shRNA (UAS) - Lentiviral mouse Ccar1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Lentiviral human ARID1A shRNA (UAS) - Lentiviral human ARID1A shRNA (UAS) (25)
GTR15094217 1 Vial

Lentiviral human ARID1A shRNA (UAS) - Lentiviral human ARID1A shRNA (UAS) (25)

Sign In for Pricing
View Details