Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCMA/TNFRSF17, Human (HEK293, His)

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

BCMA/TNFRSF17 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcma-tnfrsf17-protein-human-hek293-his.html

Purity

98.0

Smiles

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Molecular Formula

608 (Gene_ID) Q02223 (M1-A54) (Accession)

Molecular Weight

16.9&12.4 kDa

References & Citations

[1]Nobari ST, et al. B-cell maturation antigen targeting strategies in multiple myeloma treatment, advantages and disadvantages. J Transl Med. 2022 Feb 10;20 (1) :82.|[2]Yu B, et al. BCMA-targeted immunotherapy for multiple myeloma. J Hematol Oncol. 2020 Sep 17;13 (1) :125.|[3]Perez-Amill L, et al. Preclinical development of a humanized chimeric antigen receptor against B cell maturation antigen for multiple myeloma. Haematologica. 2021 Jan 1;106 (1) :173-184.|[4]Sanchez E, et al. Soluble B-Cell Maturation Antigen Mediates Tumor-Induced Immune Deficiency in Multiple Myeloma. Clin Cancer Res. 2016 Jul 1;22 (13) :3383-97.|[5]O'Connor BP, et al. BCMA is essential for the survival of long-lived bone marrow plasma cells. J Exp Med. 2004 Jan 5;199 (1) :91-8.|[6]Tai YT, et al. APRIL and BCMA promote human multiple myeloma growth and immunosuppression in the bone marrow microenvironment. Blood. 2016 Jun 23;127 (25) :3225-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

KYNU 3'UTR Luciferase Stable Cell Line
TU012219 1.0 mL

KYNU 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat B4galt1 Pre-designed siRNA Set A
SI201265A 1 Each

Rat B4galt1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Act-CoA
MF-0064525-01 10 mg

Act-CoA

Sign In for Pricing
View Details
Act-CoA
MF-0064525-02 50 mg

Act-CoA

Sign In for Pricing
View Details
CASP14 3'UTR GFP Stable Cell Line
TU053514 1.0 mL

CASP14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MCP1 (CCL2) Human siRNA Oligo Duplex (Locus ID 6347)
SR304273 1 Kit

MCP1 (CCL2) Human siRNA Oligo Duplex (Locus ID 6347)

Sign In for Pricing
View Details