Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPRT, Human (His)

Uracil phosphoribosyltransferase homolog (UPRT) catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP) which is an important part of nucleotide metabolism. UPRT localizes to the nucleus and cytoplasm, and is a potential target for rational design of drugs to treat parasitic infections and cancer. UPRT Protein, Human (His) is the recombinant human-derived UPRT protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UPRT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uprt-protein-human-his.html

Smiles

MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTHFGQKYFGTD

Molecular Formula

139596 (Gene_ID) Q96BW1-1 (M1-D309) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS26 CytoSection
TS401411P5 25 Slides

MRPS26 CytoSection

Sign In for Pricing
View Details
CALM3/CALM2/CALM1 Recombinant Monoclonal Antibody
CSB-RA829042A0HU-01 50 μL

CALM3/CALM2/CALM1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
CALM3/CALM2/CALM1 Recombinant Monoclonal Antibody
CSB-RA829042A0HU-02 100 µL

CALM3/CALM2/CALM1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Rhesus Macaque CYP3A7 Protein, His (Fc)-Avi-tagged
CYP3A7-986R 50 µg

Recombinant Rhesus Macaque CYP3A7 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
FRMD1 (NM_001122841) Human Tagged ORF Clone
RC225817 10 µg

FRMD1 (NM_001122841) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit
RDR-PIICP-Ra-48Tests 48 Tests

Rat Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit

Sign In for Pricing
View Details