Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D2, Human (His)

The DCUN1D2 protein transfers NEDD8 from NEDD8-conjugated E2 to the cullin-RBX complex and regulates SCF-type complex activity. DCUN1D2 Protein, Human (His) is the recombinant human-derived DCUN1D2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

DCUN1D2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcun1d2-protein-human-his.html

Purity

94.00

Smiles

MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF

Molecular Formula

55208 (Gene_ID) Q6PH85-1 (M1-F259) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cdc25b Pre-designed siRNA Set B
SI102191B 1 Each

Mouse Cdc25b Pre-designed siRNA Set B

Sign In for Pricing
View Details
APC anti-human CD24
GT09052 100 Tests

APC anti-human CD24

Sign In for Pricing
View Details
RRM1 Antibody
MBS8516191-01 0.1 mg

RRM1 Antibody

Sign In for Pricing
View Details
RRM1 Antibody
MBS8516191-02 0.1 mL (AF635)

RRM1 Antibody

Sign In for Pricing
View Details
RRM1 Antibody
MBS8516191-03 0.1 mL (AF610)

RRM1 Antibody

Sign In for Pricing
View Details
RRM1 Antibody
MBS8516191-04 0.1 mL (AF405S)

RRM1 Antibody

Sign In for Pricing
View Details