IL-22R alpha 1, Rat (HEK293, His)
IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Rat (HEK293, His) is expressed by HEK 293 cells, with a His tag at the C-terminus[1].
Product Specifications
Product Name Alternative
IL-22R alpha 1 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-22r-alpha-1-protein-rat-hek293-his.html
Purity
95.0
Smiles
HTTEDTSGLLRHVKFQSSNFENILTWDAGPASAPDTVYSVEYKKYGEKEWLAKAGCQRITQKFCNLTVETRNHTEFYYAKVTAVSSGGPPVTKMTDRFSSLQHTTIRPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLKLHVNHTYQMNLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYTCRVKTLPDRTWA
Molecular Formula
362629 (Gene_ID) A0A8I6A0L8/NP_001178798.1 (H16-A228) (Accession)
Molecular Weight
33-45 kDa.
References & Citations
[1]Cui X, et, al. IL22 furthers malignant transformation of rat mesenchymal stem cells, possibly in association with IL22RA1/STAT3 signaling. Oncol Rep. 2019 Apr;41 (4) :2148-2158.|[2]Kragstrup TW, et, al. The IL-20 Cytokine Family in Rheumatoid Arthritis and Spondyloarthritis. Front Immunol. 2018 Sep 25;9:2226.|[3]Persaud L, et, al. Mechanism of Action and Applications of Interleukin 24 in Immunotherapy. Int J Mol Sci. 2016 Jun 2;17 (6) :869.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal TLR2 Antibody (67N17F8) [FITC]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP3-24059JF525 0.1 mL
Rabbit Monoclonal CD23/Fc epsilon RII Antibody (FCER2/8236R) [Janelia Fluor 525]
Sign In for Pricing
View Details 
GTR15141312 1 Vial
Lentiviral human FBXW2 shRNA (UAS) - Lentiviral human FBXW2 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details