RBP7, Human
Product Specifications
UNSPSC Description
RBP7 is pivotal in intracellularly transporting retinol. RBP7 Protein, Human is the recombinant human-derived RBP7 protein, expressed by E. coli , with tag free. The total length of RBP7 Protein, Human is 134 a.a., with molecular weight of ~14.0 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rbp7-protein-human.html
Smiles
MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Molecular Weight
Approximately 14.0 kDa
Shipping Conditions
Room temperature
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6177735-01 0.1 mL
AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO) (FITC)
Sign In for Pricing
View Details 
MBS6177735-02 5x 0.1 mL
AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO) (FITC)
Sign In for Pricing
View Details 
