Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Angiopoietin-2 (Angpt2)

Product Specifications

Product Name Alternative

ANG-2

Abbreviation

Recombinant Rat Angpt2 protein

Gene Name

Angpt2

UniProt

O35462

Expression Region

19-496aa

Organism

Rattus norvegicus (Rat)

Target Sequence

YNNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHSVQLQSMKEQKDQLQVLVSKQSSVIDELEKKLVTATVNNSVLQKQQHDLMETVNSLLTMMSSPDYKSSVAVPKEEKTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEVKAYCDMDMGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTSGHRYVLKIQLKDWEGSEAHSLYEHFYLSGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLTGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal. Involved in the regulation of lymphangiogenesis.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-100 1x 100 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (PRLR/742), CF740 conjugate, 0.1mg/mL
BNC740742-100 1x 100 µL

Prolactin Receptor (PRLR/742), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL
BNC681059-100 1x 100 µL

CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF594 conjugate, 0.1mg/mL
BNC941803-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details