Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP2, Human

RBP2 is pivotal for intracellular retinol transport. RBP2 Protein, Human is the recombinant human-derived RBP2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RBP2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp2-protein-human.html

Purity

95.0

Smiles

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Molecular Formula

5948 (Gene_ID) P50120 (M1-K134) (Accession)

Molecular Weight

Approximately 16.78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Complement protein 4 (C4) ELISA Kit
orb3012298-01 48 Tests

Monkey Complement protein 4 (C4) ELISA Kit

Sign In for Pricing
View Details
Monkey Complement protein 4 (C4) ELISA Kit
orb3012298-02 96 Tests

Monkey Complement protein 4 (C4) ELISA Kit

Sign In for Pricing
View Details
Monkey Complement protein 4 (C4) ELISA Kit
orb3012298-03 5 x 96 T

Monkey Complement protein 4 (C4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella Sonnei rnfB Protein (aa 1-192)
VAng-0094Lsx-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei rnfB Protein (aa 1-192)

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class I C (MHCC) ELISA Kit
DLR-MHCC-Hu-48T 48 Tests

Human Major Histocompatibility Complex Class I C (MHCC) ELISA Kit

Sign In for Pricing
View Details
Human Soluble Endoglin (sENG / sCD105) ELISA Kit
MBS269385-01 48 Well

Human Soluble Endoglin (sENG / sCD105) ELISA Kit

Sign In for Pricing
View Details