Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP2, Human

RBP2 is pivotal for intracellular retinol transport. RBP2 Protein, Human is the recombinant human-derived RBP2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RBP2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp2-protein-human.html

Purity

95.0

Smiles

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Molecular Formula

5948 (Gene_ID) P50120 (M1-K134) (Accession)

Molecular Weight

Approximately 16.78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARL antibody - N-terminal region
MBS3207560-01 0.1 mL

PARL antibody - N-terminal region

Sign In for Pricing
View Details
PARL antibody - N-terminal region
MBS3207560-02 5x 0.1 mL

PARL antibody - N-terminal region

Sign In for Pricing
View Details
Anti-Human NECTIN4/PVRL4 Antibody (SAA0403), PerCP
MBS1585010-01 50 Tests

Anti-Human NECTIN4/PVRL4 Antibody (SAA0403), PerCP

Sign In for Pricing
View Details
Anti-Human NECTIN4/PVRL4 Antibody (SAA0403), PerCP
MBS1585010-02 100 Tests

Anti-Human NECTIN4/PVRL4 Antibody (SAA0403), PerCP

Sign In for Pricing
View Details
Anti-Human NECTIN4/PVRL4 Antibody (SAA0403), PerCP
MBS1585010-03 5x 100 Tests

Anti-Human NECTIN4/PVRL4 Antibody (SAA0403), PerCP

Sign In for Pricing
View Details
PRRC2A siRNA (Human)
orb1862945-01 15 nmol

PRRC2A siRNA (Human)

Sign In for Pricing
View Details