Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP2, Human

RBP2 is pivotal for intracellular retinol transport. RBP2 Protein, Human is the recombinant human-derived RBP2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RBP2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp2-protein-human.html

Purity

95.0

Smiles

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Molecular Formula

5948 (Gene_ID) P50120 (M1-K134) (Accession)

Molecular Weight

Approximately 16.78 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5A1P6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV719241 1.0 µg DNA

ATP5A1P6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: LBI1D10]
AMM18476V 100 µL

ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: LBI1D10]

Sign In for Pricing
View Details
Human OSBP2 knockout cell line
ABC-KH10945 1 Vial

Human OSBP2 knockout cell line

Sign In for Pricing
View Details
ELISA Kit For Wnt inhibitory factor 1
E2985m 96 Tests

ELISA Kit For Wnt inhibitory factor 1

Sign In for Pricing
View Details
VAMP8 Antibody
MBS8517176-01 0.05 mg

VAMP8 Antibody

Sign In for Pricing
View Details
VAMP8 Antibody
MBS8517176-02 0.1 mg

VAMP8 Antibody

Sign In for Pricing
View Details