Recombinant Canine coronavirus Nucleoprotein (N)
Product Specifications
Product Name Alternative
(Nucleocapsid protein) (NC) (Protein N)
Abbreviation
Recombinant Canine coronavirus N protein
Gene Name
N
UniProt
Q7T6S8
Expression Region
1-382aa
Organism
Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)
Target Sequence
MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPVTLKQGSKFWDLCPRDFVPLKIGNKDQQIGYWNRQIRYRMVKGQRKDLPERWFFYYLGTGPHADAKFKQKLDGVVWVAKEGAMTKPTTLGTRGTNNESKALKFDVKVPSEFQLEVNQSRDNSRSRSQSRSQSRTRAQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRARSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSSANFGDSDLVANGNSAKHYPQLAECVPSVSSILFGSHWTAKEDGDQIEVTFTHKYHLPKDDPKTGQFLQQINAYARPSEVAKEQRLRKARSKSAERVEQEVVPDALTENYTDVFDDTQVEIIDEVTN
Tag
N-terminal 6xHis-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Microbiology
Relevance
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
49.5 kDa
References & Citations
"Molecular characterization of a virulent canine coronavirus BGF strain." Sanchez-Morgado J.M., Poynter S., Morris T.H. Virus Res. 104:27-31 (2004)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882303-500 1x 500 µL
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042067-100 1x 100 µL
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680201-500 1x 500 µL
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401475-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details