Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIBG, Human (His)

WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

WIBG Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wibg-protein-human-his.html

Smiles

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

Molecular Formula

84305 (Gene_ID) Q9BRP8 (M1-L204) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA2 Antibody
OC-2335-01 50 μL

PSMA2 Antibody

Sign In for Pricing
View Details
PSMA2 Antibody
OC-2335-02 100 µL

PSMA2 Antibody

Sign In for Pricing
View Details
PSMA2 Antibody
OC-2335-03 1 mL

PSMA2 Antibody

Sign In for Pricing
View Details
MEGF9 Antibody (Biotin)
KB-26666-01 50 μL

MEGF9 Antibody (Biotin)

Sign In for Pricing
View Details
MEGF9 Antibody (Biotin)
KB-26666-02 100 µL

MEGF9 Antibody (Biotin)

Sign In for Pricing
View Details
MEGF9 Antibody (Biotin)
KB-26666-03 1 mL

MEGF9 Antibody (Biotin)

Sign In for Pricing
View Details