Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIBG, Human (His)

WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

WIBG Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wibg-protein-human-his.html

Smiles

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

Molecular Formula

84305 (Gene_ID) Q9BRP8 (M1-L204) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optitrol Chagas
SR16025 1 mL

Optitrol Chagas

Sign In for Pricing
View Details
CuLlin 5 (CuL5) (NM_003478) Human Recombinant Protein
TP309273M 100 µg

CuLlin 5 (CuL5) (NM_003478) Human Recombinant Protein

Sign In for Pricing
View Details
CENPE Rabbit Monoclonal Antibody [Clone ID: CA8]
TA399796 0.2 mg

CENPE Rabbit Monoclonal Antibody [Clone ID: CA8]

Sign In for Pricing
View Details
TOLLIP (NM_019009) Human Recombinant Protein
TP720557L 500 µg

TOLLIP (NM_019009) Human Recombinant Protein

Sign In for Pricing
View Details
Histone H4 (acetyl K5) Recombinant Rabbit monoclonal Antibody
HA750050 100 µL

Histone H4 (acetyl K5) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human KRTAP4-1 activation kit by CRISPRa
GA113838 1 Kit

Human KRTAP4-1 activation kit by CRISPRa

Sign In for Pricing
View Details