Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD19 sgRNA CRISPR Lentivector set (Human)
K1128301 3x 1.0 µg

KCTD19 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
RANBP3L CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38479154 3x 1.0 µg DNA

RANBP3L CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ICI-200880
HY-106293 1 Each

ICI-200880

Sign In for Pricing
View Details
ADA2 beta (TADA2B) (NM_152293) Human Tagged ORF Clone Lentiviral Particle
RC220038L4V 200 µL

ADA2 beta (TADA2B) (NM_152293) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PPP3R1 Protein Vector (Rat) (pPM-C-HA)
PV295796 500 ng

PPP3R1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human METTL3 Protein, N-His
YHJ15401 100 μg

Recombinant Human METTL3 Protein, N-His

Sign In for Pricing
View Details