Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm43 3'UTR GFP Stable Cell Line
TU167629 1.0 mL

Rbm43 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Interleukin 2 (IL-2) (MaxLight 490)
MBS6482507-01 0.1 mL

Interleukin 2 (IL-2) (MaxLight 490)

Sign In for Pricing
View Details
Interleukin 2 (IL-2) (MaxLight 490)
MBS6482507-02 5x 0.1 mL

Interleukin 2 (IL-2) (MaxLight 490)

Sign In for Pricing
View Details
PDLIM5 Polyclonal Antibody
MBS9244823-01 0.1 mL

PDLIM5 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM5 Polyclonal Antibody
MBS9244823-02 5x 0.1 mL

PDLIM5 Polyclonal Antibody

Sign In for Pricing
View Details
RPA3 polyclonal antibody
BS8384-01 50 µL

RPA3 polyclonal antibody

Sign In for Pricing
View Details