Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Amino-3-cyclopropylpropanoic acid
MBS9022934-01 1 g

3-Amino-3-cyclopropylpropanoic acid

Sign In for Pricing
View Details
3-Amino-3-cyclopropylpropanoic acid
MBS9022934-02 5x 1 g

3-Amino-3-cyclopropylpropanoic acid

Sign In for Pricing
View Details
Rabbit anti-CCT3 Antibody
MBS4511279-01 0.05 mL

Rabbit anti-CCT3 Antibody

Sign In for Pricing
View Details
Rabbit anti-CCT3 Antibody
MBS4511279-02 0.1 mL

Rabbit anti-CCT3 Antibody

Sign In for Pricing
View Details
Rabbit anti-CCT3 Antibody
MBS4511279-03 5x 0.1 mL

Rabbit anti-CCT3 Antibody

Sign In for Pricing
View Details
TROP-2 Protein, Human, Recombinant (aa 88-274, hFc)
MF-0106308-01 5 µg

TROP-2 Protein, Human, Recombinant (aa 88-274, hFc)

Sign In for Pricing
View Details