Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CXCL4/ PF4/Antibody (SAA0463), PerCP
HY443147-01 1 Each

Anti-Human CXCL4/ PF4/Antibody (SAA0463), PerCP

Sign In for Pricing
View Details
Anti-Human CXCL4/ PF4/Antibody (SAA0463), PerCP
HY443147-02 100 Tests

Anti-Human CXCL4/ PF4/Antibody (SAA0463), PerCP

Sign In for Pricing
View Details
Recombinant Mouse FLT3L/ Flt3 ligand Protein, Untagged, E.coli-10ug
QP5405-10ug 10ug

Recombinant Mouse FLT3L/ Flt3 ligand Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
Rat LNPEP shRNA Plasmid
abx987686-01 150 µg

Rat LNPEP shRNA Plasmid

Sign In for Pricing
View Details
Rat LNPEP shRNA Plasmid
abx987686-02 300 µg

Rat LNPEP shRNA Plasmid

Sign In for Pricing
View Details
SNORD116-26 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2248305 3x 1.0 µg

SNORD116-26 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details