Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gbp7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3643607 1.0 µg DNA

Gbp7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PoFAine Heat Shock Protein 40,HSP-40 ELISA Kit
CN-01299P2 48T

PoFAine Heat Shock Protein 40,HSP-40 ELISA Kit

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)
MBS6218387-01 0.1 mL

OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)
MBS6218387-02 5x 0.1 mL

OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 550)

Sign In for Pricing
View Details
Mouse metanephrine (MN) ELISA Kit
MBS265523-01 48 Well

Mouse metanephrine (MN) ELISA Kit

Sign In for Pricing
View Details
Mouse metanephrine (MN) ELISA Kit
MBS265523-02 96 Well

Mouse metanephrine (MN) ELISA Kit

Sign In for Pricing
View Details