Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Monkeypox Virus Ankyrin-like Protein, 32.6 kDa
MPXV-0183 100 µg

Recombinant Monkeypox Virus Ankyrin-like Protein, 32.6 kDa

Sign In for Pricing
View Details
Zfp219 (NM_001007681) Rat Tagged Lenti ORF Clone
RR210858L4 10 µg

Zfp219 (NM_001007681) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VKORC1 siRNA (Rat)
MBS8210326-01 15 nmol

VKORC1 siRNA (Rat)

Sign In for Pricing
View Details
VKORC1 siRNA (Rat)
MBS8210326-02 30 nmol

VKORC1 siRNA (Rat)

Sign In for Pricing
View Details
VKORC1 siRNA (Rat)
MBS8210326-03 5x 30 nmol

VKORC1 siRNA (Rat)

Sign In for Pricing
View Details
BS69 (ZMYND11) (NM_006624) Human Tagged Lenti ORF Clone
RC220298L4 10 µg

BS69 (ZMYND11) (NM_006624) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details