Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps29 (NM_012876) Rat Tagged Lenti ORF Clone
RR215537L3 10 µg

Rps29 (NM_012876) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fukutin (FKTN) Mouse ELISA Kit
D5331 96 Tests

Fukutin (FKTN) Mouse ELISA Kit

Sign In for Pricing
View Details
SulT2A1 antibody
10R-6005 100 ul

SulT2A1 antibody

Sign In for Pricing
View Details
SMARCD1/3 Blocking Peptide
MBS9620461-01 1 mg

SMARCD1/3 Blocking Peptide

Sign In for Pricing
View Details
SMARCD1/3 Blocking Peptide
MBS9620461-02 5x 1 mg

SMARCD1/3 Blocking Peptide

Sign In for Pricing
View Details
Recombinant IL-15 Rabbit mAb
E38MA4688 100 µL

Recombinant IL-15 Rabbit mAb

Sign In for Pricing
View Details