Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Growth Factor Receptor (HGFR) Sheep ELISA Kit
D9977 96 Tests

Hepatocyte Growth Factor Receptor (HGFR) Sheep ELISA Kit

Sign In for Pricing
View Details
Phospho-Akt (Thr450) Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-52131R-BF350-01 20 µL

Phospho-Akt (Thr450) Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Phospho-Akt (Thr450) Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-52131R-BF350-02 100 µL

Phospho-Akt (Thr450) Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
CSPS (SuLT1A3) (NM_001017387) Human Tagged ORF Clone
RC219331 10 µg

CSPS (SuLT1A3) (NM_001017387) Human Tagged ORF Clone

Sign In for Pricing
View Details
UGT1A6 ORF Vector (Human) (pORF)
49117011 1.0 µg DNA

UGT1A6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SEC61A1/2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62030R-BF350-01 20 µL

SEC61A1/2 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details