Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IgE Antibody (E411) [DyLight 680]
NB110-8338FR 0.2 mL

Mouse Monoclonal IgE Antibody (E411) [DyLight 680]

Sign In for Pricing
View Details
ZBTB17 Antibody (N-term) Blocking Peptide
MBS9223892-01 0.5 mg

ZBTB17 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
ZBTB17 Antibody (N-term) Blocking Peptide
MBS9223892-02 5x 0.5 mg

ZBTB17 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Lentiviral human SNRPA1 shRNA (UAS) - Lentiviral human SNRPA1 shRNA (UAS, GFP) plasmid
GTR15309589 1 Vial

Lentiviral human SNRPA1 shRNA (UAS) - Lentiviral human SNRPA1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
MSH2 (NM_000251) Human Mutant ORF Clone
RC401879 10 µg

MSH2 (NM_000251) Human Mutant ORF Clone

Sign In for Pricing
View Details
Recombinant Rat Serine protease inhibitor Kazal-type 3 (Spink3)
MBS1038773-01 0.02 mg (E-Coli)

Recombinant Rat Serine protease inhibitor Kazal-type 3 (Spink3)

Sign In for Pricing
View Details