Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBAKDN Human shRNA Plasmid Kit (Locus ID 389458)
TL319276 1 Kit

RBAKDN Human shRNA Plasmid Kit (Locus ID 389458)

Sign In for Pricing
View Details
PSPN Protein Vector (Rat) (pPM-C-HA)
PV296980 500 ng

PSPN Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NT5C3 sgRNA CRISPR Lentivector (Human) (Target 3)
K1459404 1.0 µg DNA

NT5C3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Eaf2 (NM_172047) Rat Tagged ORF Clone Lentiviral Particle
RR204903L4V 200 µL

Eaf2 (NM_172047) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Monoclonal RNA Polymerase II/POLR2A Antibody (POLR2A/9089R) [FITC]
NBP3-24041F 0.1 mL

Rabbit Monoclonal RNA Polymerase II/POLR2A Antibody (POLR2A/9089R) [FITC]

Sign In for Pricing
View Details
Mouse Monoclonal THSD1 Antibody (541213) [PerCP]
FAB5178C 0.1 mL

Mouse Monoclonal THSD1 Antibody (541213) [PerCP]

Sign In for Pricing
View Details