Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-human-hek293-hfc-myc.html

Smiles

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Formula

8744 (Gene_ID) P41273 (R71-E254) (Accession)

Molecular Weight

48.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3.3 Rabbit mAb
E60M1554 100 µL

Histone H3.3 Rabbit mAb

Sign In for Pricing
View Details
Mkrn1 Knockout RAW 264.7 Cell Line
ARG43981 1 Million

Mkrn1 Knockout RAW 264.7 Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Lgr5/GPR49 Antibody (707042) [mFluor Violet 450 SE]
FAB8078MFV450 0.1 mL

Mouse Monoclonal Lgr5/GPR49 Antibody (707042) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Human CAGE1/CTAG3 Protein, N-His
E55P4245 50 µg

Recombinant Human CAGE1/CTAG3 Protein, N-His

Sign In for Pricing
View Details
MKNK1 Polyclonal Antibody
E-AB-92045-01 60 µL

MKNK1 Polyclonal Antibody

Sign In for Pricing
View Details
MKNK1 Polyclonal Antibody
E-AB-92045-02 120 µL

MKNK1 Polyclonal Antibody

Sign In for Pricing
View Details