Caspase-10/CASP10, Human (His)
Caspase-10 Protein, Human (His) is an approximately 33.0 kDa caspase-10 protein with a His-flag, expressed in E. coli. Caspase-10 belongs to the caspase family and involved in the execution-phase of cell apoptosis[1].
Product Specifications
Product Name Alternative
Caspase-10/CASP10 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/caspase-10-protein-human-his.html
Smiles
VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSIHHHHHH
Molecular Formula
843 (Gene_ID) Q92851-4 (V220-R472) (Accession)
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Katherine Wachmann, et al. Activation and specificity of human caspase-10. Biochemistry. 2010 Sep 28;49 (38) :8307-15.|[2]Sebastian Horn, et al. Caspase-10 Negatively Regulates Caspase-8-Mediated Cell Death, Switching the Response to CD95L in Favor of NF-κB Activation and Cell Survival. Cell Rep. 2017 Apr 25;19 (4) :785-797.|[3]Andrea Mohr, et al. Caspase-10: a molecular switch from cell-autonomous apoptosis to communal cell death in response to chemotherapeutic drug treatment. Cell Death Differ. 2018 Feb;25 (2) :340-352.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS060790 Inquire
Cavy Transmembrane Protein 2 Like Protein ELISA Kit
Sign In for Pricing
View Details 
RR201462L3V 200 µL
Olr462 (NM_001000295) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details