Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Polycomb complex protein BMI-1 (BMI1), partial

Product Specifications

Product Name Alternative

Polycomb group RING finger protein 4RING finger protein 51

Abbreviation

Recombinant Human BMI1 protein, partial

Gene Name

BMI1

UniProt

P35226

Expression Region

1-250aa

Organism

Homo sapiens (Human)

Target Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transcription

Relevance

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin rodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility

Molecular Weight

56.4 kDa

References & Citations

Characterization and chromosomal localization of the human proto-oncogene BMI-1.Alkema M.J., Wiegand J., Raap A.K., Berns A., van Lohuizen M.Hum. Mol. Genet. 2:1597-1603 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ift43 3'UTR Luciferase Stable Cell Line
TU206137 1.0 mL

Ift43 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey Hemoglobin (Hb) ELISA Kit
MBS2801928-01 48 Tests

Monkey Hemoglobin (Hb) ELISA Kit

Sign In for Pricing
View Details
Monkey Hemoglobin (Hb) ELISA Kit
MBS2801928-02 96 Tests

Monkey Hemoglobin (Hb) ELISA Kit

Sign In for Pricing
View Details
Monkey Hemoglobin (Hb) ELISA Kit
MBS2801928-03 5x 96 Tests

Monkey Hemoglobin (Hb) ELISA Kit

Sign In for Pricing
View Details
Monkey Hemoglobin (Hb) ELISA Kit
MBS2801928-04 10x 96 Tests

Monkey Hemoglobin (Hb) ELISA Kit

Sign In for Pricing
View Details
4-Bromo-1-isobutyl-3,5-dimethyl-1H-pyrazole
OR1096486 1 Each

4-Bromo-1-isobutyl-3,5-dimethyl-1H-pyrazole

Sign In for Pricing
View Details