WIF-1, Mouse (HEK293, His)
WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway.In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development.WIF-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived WIF-1 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
WIF-1 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/wif1-protein-mouse-hek293-his.html
Purity
95.50
Smiles
MARRRAFPAFALRLWSILPCLLLLRADAGQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIW
Molecular Formula
24117 (Gene_ID) Q9WUA1 (M1-W379) (Accession)
Molecular Weight
Approximately 44 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400012-100 1x 100 µL
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details