Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18, Dog (His)

IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

IL-18 Protein, Dog (His), Dog, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18-protein-dog-his.html

Smiles

YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Molecular Formula

403796 (Gene_ID) Q9XSR0 (Y37-S193) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Xpress™ Human SDF2 Over-expressing Stable Cell Line
ABC-X2757 1 Vial

Xpress™ Human SDF2 Over-expressing Stable Cell Line

Ask
View Details
Cat Gamma-Aminobutyric Acid (gABA) ELISA Kit
YLA0012CT-01 48 Tests

Cat Gamma-Aminobutyric Acid (gABA) ELISA Kit

Ask
View Details
Cat Gamma-Aminobutyric Acid (gABA) ELISA Kit
YLA0012CT-02 96 Tests

Cat Gamma-Aminobutyric Acid (gABA) ELISA Kit

Ask
View Details
Choline Transporter-Like protein 4 (SLC44A4) Human ELISA Kit
C3460 96 Tests

Choline Transporter-Like protein 4 (SLC44A4) Human ELISA Kit

Ask
View Details
Biotin-Linked Polyclonal Antibody to Immunoglobulin G2a (IgG2a)
MBS2113807-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Immunoglobulin G2a (IgG2a)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Immunoglobulin G2a (IgG2a)
MBS2113807-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Immunoglobulin G2a (IgG2a)

Ask
View Details