Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18, Dog (His)

IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

IL-18 Protein, Dog (His), Dog, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18-protein-dog-his.html

Smiles

YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Molecular Formula

403796 (Gene_ID) Q9XSR0 (Y37-S193) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Hypocretin Neuropeptide Precursor (HCRT) ELISA Kit
abx152594-01 96 Tests

Human Hypocretin Neuropeptide Precursor (HCRT) ELISA Kit

Ask
View Details
Human Hypocretin Neuropeptide Precursor (HCRT) ELISA Kit
abx152594-02 5x 96 Tests

Human Hypocretin Neuropeptide Precursor (HCRT) ELISA Kit

Ask
View Details
Human Hypocretin Neuropeptide Precursor (HCRT) ELISA Kit
abx152594-03 10x 96 Tests

Human Hypocretin Neuropeptide Precursor (HCRT) ELISA Kit

Ask
View Details
Anti-CD69 (Rabbit, Monoclonal)
A102445 100 µL

Anti-CD69 (Rabbit, Monoclonal)

Ask
View Details
OR4N2 Human shRNA Lentiviral Particle (Locus ID 390429)
TL310838V 500 µL Each

OR4N2 Human shRNA Lentiviral Particle (Locus ID 390429)

Ask
View Details
CellTracker Blue CMF2HC Dye
MF-0146915-01 25 mg

CellTracker Blue CMF2HC Dye

Ask
View Details