Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18, Dog (His)

IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

IL-18 Protein, Dog (His), Dog, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18-protein-dog-his.html

Smiles

YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Molecular Formula

403796 (Gene_ID) Q9XSR0 (Y37-S193) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal HLA DRB3 Antibody (Bra30) - Azide and BSA Free
NBP3-08911 100 µg

Mouse Monoclonal HLA DRB3 Antibody (Bra30) - Azide and BSA Free

Ask
View Details
ZNF131 antibody - N-terminal region
MBS3208644-01 0.1 mL

ZNF131 antibody - N-terminal region

Ask
View Details
ZNF131 antibody - N-terminal region
MBS3208644-02 5x 0.1 mL

ZNF131 antibody - N-terminal region

Ask
View Details
SALL1 Human siRNA Oligo Duplex (Locus ID 6299)
SR304234 1 Kit

SALL1 Human siRNA Oligo Duplex (Locus ID 6299)

Ask
View Details
Serine Protease HTRA2 (PRSS25) Rabbit anti-Human Polyclonal (C-Terminus) Antibody
GWB-A2B924 0.05 mg

Serine Protease HTRA2 (PRSS25) Rabbit anti-Human Polyclonal (C-Terminus) Antibody

Ask
View Details
IGFBP1 polyclonal antibody
BS74625-01 50 µL

IGFBP1 polyclonal antibody

Ask
View Details